Not even a lead single that we all hate? LET’S GO
― self-clowning oven (Murgatroid), Thursday, 23 July 2020 12:06 (six years ago)
what??? the name makes me hope it's a step away from the pop of her last few albums which has really had diminishing returns
― ufo, Thursday, 23 July 2020 12:10 (six years ago)
Folklore
she is such a hack
― imago, Thursday, 23 July 2020 12:10 (six years ago)
oh collaborators this time are aaron dessner, justin vernon, william bowery (which is not a name i recognise at all or can find anything about?) and antonoff of course so i'll expect it's indeed folk-y
― ufo, Thursday, 23 July 2020 12:13 (six years ago)
jesus
isn’t kanye releasing an album tomorrow too?
― monotony, Thursday, 23 July 2020 12:15 (six years ago)
tracklist:the 1cardiganthe last great american dynastyexile (feat. bon iver)my tears ricochetmirrorballsevenaugustthis is me tryingillicit affairsinvisible stringmad woman epiphanybettypeacehoax
bonus track:the lakes
― ufo, Thursday, 23 July 2020 12:16 (six years ago)
Rodrigo Prieto, who’s helped out on the last few Scorsese movies, is the cinematographer for the “cardigan” video - is she about to put out a good music video for once???
― self-clowning oven (Murgatroid), Thursday, 23 July 2020 12:19 (six years ago)
(I mean, he’s also worked with Iñárritu but let’s not dwell on that)
― self-clowning oven (Murgatroid), Thursday, 23 July 2020 12:20 (six years ago)
the look what you made me do video was good!
― ufo, Thursday, 23 July 2020 12:21 (six years ago)
the last great american dynasty
even she watched the jordan doc
― johnny crunch, Thursday, 23 July 2020 12:22 (six years ago)
omg this sounds kind of awful but will probs be amazing
― überweiss, Thursday, 23 July 2020 12:26 (six years ago)
This is the concept I've wanted from her since forever. Can it live up to my expectations? At least it's a good idea to just let it all out without the usual bluster of a pre-release hype campaign. That's refreshing
― abcfsk, Thursday, 23 July 2020 12:30 (six years ago)
Missed opportunity for a Myrkur collaboration IMO but I guess she didn't want the whole 'Aryan goddess' thing to bubble up again.
― but also fuck you (unperson), Thursday, 23 July 2020 12:35 (six years ago)
It’s a concept album about sacrificing Varg.
― Ned Raggett, Thursday, 23 July 2020 12:48 (six years ago)
i’m overwhelmed
― mellon collie and the infinite bradness (BradNelson), Thursday, 23 July 2020 12:53 (six years ago)
pic.twitter.com/w2hhXfRi0M— Aaron Dessner (@aaron_dessner) July 23, 2020
― abcfsk, Thursday, 23 July 2020 13:02 (six years ago)
an entire brand new album of songs I’ve poured all of my whims, dreams, fears, and musings into.
Would be funny if they were all songs about unicorns, eating babies, not studying for the test, Trump, teeth falling out and what if giraffes could speak.
― Josh in Chicago, Thursday, 23 July 2020 13:03 (six years ago)
Seriously, though, I'm really intrigued by the notion of Swift working fast and spontaneously and foregoing the pop polish/pressures.
― Josh in Chicago, Thursday, 23 July 2020 13:06 (six years ago)
Can anyone recommend some good folk/folk-esque albums released this year?
― pomenitul, Thursday, 23 July 2020 13:09 (six years ago)
Bonny Light Horseman for sure
― k*r*n koltrane (Simon H.), Thursday, 23 July 2020 13:10 (six years ago)
lol this is BREAKING NEWS on p4k, writ large on a red banner.
xp thanks.
― pomenitul, Thursday, 23 July 2020 13:11 (six years ago)
so this is all her rejected Cats songs, then
― k*r*n koltrane (Simon H.), Thursday, 23 July 2020 13:13 (six years ago)
And extra special thanks to my amazing manager and as always to heroic Wuotan who oversees Valhalla and shall lead us to glory
― Paul Ponzi, Thursday, 23 July 2020 13:14 (six years ago)
i’m so happy
― mellon collie and the infinite bradness (BradNelson), Thursday, 23 July 2020 13:14 (six years ago)
lol I forgot she was in Cats. I forgot there was a Cats!
― Josh in Chicago, Thursday, 23 July 2020 13:20 (six years ago)
if you had seen cats you would not forget there was a cats
― mellon collie and the infinite bradness (BradNelson), Thursday, 23 July 2020 13:21 (six years ago)
no lies detected
― k*r*n koltrane (Simon H.), Thursday, 23 July 2020 13:23 (six years ago)
Not exactly under the radar but Owen Pallet, Blake Mills & Phoebe Bridgers albums?
― chonky floof (groovypanda), Thursday, 23 July 2020 13:35 (six years ago)
the new Fabiano do Nascimento is good
― imago, Thursday, 23 July 2020 13:36 (six years ago)
I guess those are folk-esque, yeah (I’ve heard the Pallett and Bridgers, liked ‘em both).xp
― pomenitul, Thursday, 23 July 2020 13:37 (six years ago)
There's a new Gillian Welch.
― Josh in Chicago, Thursday, 23 July 2020 13:42 (six years ago)
I know she is not like this at all but my first reaction to the title "Folklore" was "oh cool, she's going full-Varg"
― shout-out to his family (DJP), Thursday, 23 July 2020 13:45 (six years ago)
hahahaha I see Ned got there first
― shout-out to his family (DJP), Thursday, 23 July 2020 13:46 (six years ago)
Damn it, now I actually want a Taylor Swift folk-metal album.
― Feel a million filaments (Sund4r), Thursday, 23 July 2020 13:47 (six years ago)
Taylor Swift Presents: The Prussian Blue Songbook
― shout-out to his family (DJP), Thursday, 23 July 2020 13:47 (six years ago)
"When you can tour again, what will it be like?"
"Ritualistic."
― Ned Raggett, Thursday, 23 July 2020 14:05 (six years ago)
"Here's the world premiere of the new Taylor Swift single, 'Solstice Blindfold'"
― shout-out to his family (DJP), Thursday, 23 July 2020 14:08 (six years ago)
Leaked first single:https://youtu.be/AcAl4Fr2qQU
― pomenitul, Thursday, 23 July 2020 14:11 (six years ago)
But I got smarter, built an altar in the nick of timeHoney, I summoned up the dead, I do it all the timeI've got a list of souls and yours is in red, sacrificedChop your neck once, then I chop it twice, oh!
Look who you made me kill.
― Ned Raggett, Thursday, 23 July 2020 14:12 (six years ago)
now set it to an Antonoff beat.
― TikTok to the (Alfred, Lord Sotosyn), Thursday, 23 July 2020 14:19 (six years ago)
the art made me think of this so hopefully that's her new direction
― k*r*n koltrane (Simon H.), Thursday, 23 July 2020 14:30 (six years ago)
Goole on Twitter is monitoring this for the "if you sing about forests you are straight up racist" rule, he recorded expressed concern over the song "The Lakes" which could be seen as forest fash adjacent
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Thursday, 23 July 2020 15:09 (six years ago)
pity forests and lakes, they didn't ask for this
― k*r*n koltrane (Simon H.), Thursday, 23 July 2020 15:10 (six years ago)
Anyway this is all reminding me what I think of the National, which is a big blank space upon which I have not projected any thoughts.
― Ned Raggett, Thursday, 23 July 2020 15:25 (six years ago)
That’s exactly what they want you to think.
― pomenitul, Thursday, 23 July 2020 15:30 (six years ago)
"I am a big blank space / upon which I have not / projected any thoughts" is one of my favorite National lyrics
― k*r*n koltrane (Simon H.), Thursday, 23 July 2020 15:32 (six years ago)
I'm glad to know I can score some extra coin this way.
― Ned Raggett, Thursday, 23 July 2020 15:40 (six years ago)
very funny to me this is prob her best album art ever
― mellon collie and the infinite bradness (BradNelson), Thursday, 23 July 2020 16:56 (six years ago)
anyway i bought a copy
― mellon collie and the infinite bradness (BradNelson), Thursday, 23 July 2020 16:57 (six years ago)
https://www.youtube.com/watch?v=BDkLfpyqbm0
― Fuck the NRA (ulysses), Thursday, 23 July 2020 17:02 (six years ago)
Wow, this fan-soaking is so Garth-level I'm expecting her to roll out SwifTunes in 2021. https://t.co/34b6x1hlWq— Keith Harris (@useful_noise) July 23, 2020
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Thursday, 23 July 2020 19:37 (six years ago)
fan-soaking
https://pbs.twimg.com/media/EVftr8XUEAEIcnT?format=jpg&name=medium
― Josh in Chicago, Thursday, 23 July 2020 19:41 (six years ago)
Wow, this fan-soaking is so Garth-level I'm expecting her to roll out SwifTunes in 2021.
What?
― peace, man, Thursday, 23 July 2020 19:59 (six years ago)
welcome back, Aja
― shout-out to his family (DJP), Thursday, 23 July 2020 20:19 (six years ago)
Keith was Ajakitty??
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Thursday, 23 July 2020 21:41 (six years ago)
Taylor was.
― Fuck the NRA (ulysses), Thursday, 23 July 2020 22:24 (six years ago)
https://cdn.shopify.com/s/files/1/0798/9273/products/vs_louise_front_2048x2048.png?v=1437941174
― Tim F, Thursday, 23 July 2020 22:36 (six years ago)
that Dessner note makes me even more excited about this, and i was already pretty excited.
― alpine static, Friday, 24 July 2020 00:04 (six years ago)
the 8 different vinyl covers and 8 different CD covers is ridiculous, though. i feel bad for obsessives who feel like they have to buy them all.
i mean they can spend their money however they want, but still
― alpine static, Friday, 24 July 2020 00:05 (six years ago)
now THAT'S how you rig the Billboard 200 chart, LOL (paging Dyl)
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 00:09 (six years ago)
are they shipping immediately? they have to if it's to game the charts with the recent rule changes
― ufo, Friday, 24 July 2020 00:10 (six years ago)
the lps won't be shipping for 16 weeks
cds go out in a month iirc
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 00:11 (six years ago)
There were 4 Deluxe Editions of Lover; each one had a different set of er.. diary entries.
― piscesx, Friday, 24 July 2020 00:12 (six years ago)
it's not really like taylor needs to game the charts anyway i guess
― ufo, Friday, 24 July 2020 00:15 (six years ago)
I was in a Target last night, and they still had a ton of Deluxe copies of Lover.
― "...And the Gods Socially Distanced" (C. Grisso/McCain), Friday, 24 July 2020 00:23 (six years ago)
Yeah, I’m just kidding around (this topic was discussed in the rolling pop thread recently)
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 00:24 (six years ago)
That album art is very Midsommar
― enochroot, Friday, 24 July 2020 01:04 (six years ago)
currently imagining the alternate universe where Taylor sticks it to the big streaming services she's tangled with in the past and made the album a Bandcamp exclusive for a week
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 03:59 (six years ago)
https://www.youtube.com/watch?v=K-a8s8OLBSE
oh my god OH MY GOD
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 04:05 (six years ago)
starting this. you can sure hear the Dessnerness of it all right away.
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 04:08 (six years ago)
completely fucking blown away by "the 1"
this is it!!!!!!
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 04:11 (six years ago)
"cardigan" is an exact Swift/LDR synthesis (the vocal phrasing!) and I like it
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 04:13 (six years ago)
my brain went straight to tori
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 04:14 (six years ago)
which i guess automatically makes it her best ldr synthesis
when youareyoungtheyassumeyouknownothing
Such an amazing song
― Tim F, Friday, 24 July 2020 04:29 (six years ago)
Also lol @ "the wedding was charming if a little gauche"
― Tim F, Friday, 24 July 2020 04:30 (six years ago)
wow the bridge in "exile" is great
― ufo, Friday, 24 July 2020 04:32 (six years ago)
and then it comes back again!
― ufo, Friday, 24 July 2020 04:33 (six years ago)
So she broke up with Joe, huh?
― triggercut, Friday, 24 July 2020 04:34 (six years ago)
Kinda her mid/late 90s lingering-impact-of-trip-hop album to a degree, isn't it? (This is very much not a complaint.) Also given the recent Hit Parade episode on Lilith Fair I'm feeling a hair of McLachlan from around then too, and similarly not a complaint.
― Ned Raggett, Friday, 24 July 2020 04:37 (six years ago)
Listening to "The Last Great American Dynasty," and it's easy to imagine Matt Berninger singing the chorus.
― jaymc, Friday, 24 July 2020 04:39 (six years ago)
"mirrorball" is soooo pretty
― ufo, Friday, 24 July 2020 04:41 (six years ago)
"A marvelous time ruining everything" is a great line that hits harder via the repetition and variation.
― Ned Raggett, Friday, 24 July 2020 04:42 (six years ago)
“august” is a cocteau twins song and it made me cry
this is the best taylor swift album and i’m not even done yet
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 04:47 (six years ago)
I don't think what the Dessners and co. bring to the table really works for me tbh
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 04:48 (six years ago)
yeah "august" is so much
― ufo, Friday, 24 July 2020 04:50 (six years ago)
Per jaymc, great thread re "Last Great American Dynasty"
obsessed with Taylor’s song about Watch Hill House and Rebekah Harkness.....yes queen give us a WASP history lesson, be the John Cheever you want you see in the world!!!!!!— rachel syme (@rachsyme) July 24, 2020
― Ned Raggett, Friday, 24 July 2020 04:52 (six years ago)
It sounds very nice, but it's also hella mellow; seven tracks in, hope it picks up a bit.
(also - I'm hesitant to type this - but in "Mirrorball," when she starts to sing "You'll find me on my tallest tiptoes," it totally sounds like she's about to sing "You'll find me on my toilet...")
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 04:53 (six years ago)
"Betty" is the best-sounding thing on here, figures it's the only Dessner-Antonoff-Swift co-production
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 04:54 (six years ago)
I thought that too.Which makes me wonder if its gonna be a another "lonely starbucks lovers" thing.
― MarkoP, Friday, 24 July 2020 04:55 (six years ago)
mellow is the dominant mood. the songcraft is out of this fucking world though
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 04:56 (six years ago)
and i haven't been studying the lyrics intently but... she seems in top form here
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 04:57 (six years ago)
I'm enjoying the mellowness. She's been on such a maximalist kick for so long. (Not that maximalism is absent here, it's just a gauzier variety.) I've always been a fan of mid-tempo and ballad Taylor.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 05:00 (six years ago)
(only halfway through the album but feels likely to be my favorite of hers since Red.)
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 05:01 (six years ago)
Damn, she DID write a folk-metal album -- from "Invisible String"
"Cold was the steel of my ax to grind for the boys who broke my heart / Now I send their babies presents"
― Ned Raggett, Friday, 24 July 2020 05:01 (six years ago)
every melody is somehow lovelier than the last
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 05:03 (six years ago)
My biggest objection to her dance-pop stuff is it tends to be too rigid to let her unfurl those long melody lines. Which she's really good at.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 05:09 (six years ago)
she keeps some of the clipped-pop delivery here but it sure works
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 05:12 (six years ago)
lol at "betty" being about being in love with a girl but she makes sure there's one line that makes it clear she's playing a male role to make it straight
― ufo, Friday, 24 July 2020 05:15 (six years ago)
so none of this is gonna be played on the radio huh
― self-clowning oven (Murgatroid), Friday, 24 July 2020 05:16 (six years ago)
seven is lovely.
― aphoristical, Friday, 24 July 2020 05:17 (six years ago)
"Cardigan" is being promoted to radio.
― jaymc, Friday, 24 July 2020 05:19 (six years ago)
overall this is quite good, probably a few tracks longer than it needed to be but that's my only complaint
― ufo, Friday, 24 July 2020 05:23 (six years ago)
Trixie Mattel will cover "Betty" by Monday.
― Ned Raggett, Friday, 24 July 2020 05:25 (six years ago)
That modulation at the end of Betty is just *chef's kiss*.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 05:31 (six years ago)
i want a whole album of "august"s
― ufo, Friday, 24 July 2020 05:35 (six years ago)
I haven’t listened to Bon Iver since Skinny Love and that EP, does he always sound like this
― self-clowning oven (Murgatroid), Friday, 24 July 2020 05:37 (six years ago)
no, it's rare to hear him in that lower register
― ufo, Friday, 24 July 2020 05:42 (six years ago)
"what if you just sang it in a normal voice, like a regular singer, Justin?"— Keith Harris (@useful_noise) July 24, 2020
― Ned Raggett, Friday, 24 July 2020 05:44 (six years ago)
well - the other characters have names, why not the narrator ("James")? it doesn't feel forced to me
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 05:47 (six years ago)
piano on Cardigan is very 'Norman Fucking Rockwell'.
― piscesx, Friday, 24 July 2020 05:50 (six years ago)
Cardigan is her best single since Blank Space.
― piscesx, Friday, 24 July 2020 05:53 (six years ago)
it was just funny because when i first heard it i thought she'd written a gay song until the one line where she no homos it by revealing the narrator's name
― ufo, Friday, 24 July 2020 05:54 (six years ago)
'james' never made anyone less gay
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 05:57 (six years ago)
Was Taylor referring to the National when she sang about that indie band in We Are Never etc
― self-clowning oven (Murgatroid), Friday, 24 July 2020 06:13 (six years ago)
Lol if so that would be the ultimate slow burn revenge on Jake Gyllenhaal
― Tim F, Friday, 24 July 2020 06:19 (six years ago)
On about the 4th time through August I realized the opening reminds me of "Life in a Northern Town." (A good thing.)
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 06:19 (six years ago)
― self-clowning oven (Murgatroid), Thursday, July 23, 2020 11:13 PM (seventeen minutes ago) bookmarkflaglink
unfortunately it was best coast
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 06:31 (six years ago)
cardigan is good but there are several tracks even better here imo! But it's not an album of singles that will take off so whatever.
Definitely some of her best melody lines ever here and they're allowed space to breathe
― abcfsk, Friday, 24 July 2020 06:32 (six years ago)
Holy shit @ "Illicit Affairs"
― Tim F, Friday, 24 July 2020 06:54 (six years ago)
I think this is the best Swift album ever and I'm still only at August on my first play
― boxedjoy, Friday, 24 July 2020 06:55 (six years ago)
still on my first time through and have been knocked for 6 a few times, most recently on "invisible string"
― monotony, Friday, 24 July 2020 06:55 (six years ago)
"August" has a very specific vibe I'm having trouble placing. The Sundays? Sixpence None the Richer?
― bunny slopes, Friday, 24 July 2020 06:57 (six years ago)
I also hear a bit of 'Back for Good' by Take That in it. The "I can see..." bit reminds me of "whatever I said, whatever I did".
― triggercut, Friday, 24 July 2020 07:01 (six years ago)
re "August", it's very "Here's Where The Story Ends" or "Homeward" from The Sundays, but the chorus also has overtones of 90s Cocteau Twins.
― Tim F, Friday, 24 July 2020 07:02 (six years ago)
Re « August » the « I can see » part reminds me of... « I’m Gonna Be (500 miles) » !
― AlXTC from Paris, Friday, 24 July 2020 07:29 (six years ago)
when brad compared it to cocteau twins i heard it immediately, the shimmering guitar + drum machine + the "i can see us lost in the memory..." melody
― ufo, Friday, 24 July 2020 07:34 (six years ago)
"Seven" is very Sufjan
― alpine static, Friday, 24 July 2020 07:35 (six years ago)
with rapping
cosigning this
― alpine static, Friday, 24 July 2020 07:37 (six years ago)
Funnier later in the chorus (?) where it sounds like she’s saying “...but I’m still on my toilet.”
― Tim F, Friday, 24 July 2020 08:21 (six years ago)
― Tim F, Friday, July 24, 2020
A helluva thing to read first thing
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 09:29 (six years ago)
I love this albumI think it reflects both the best of Taylor's writing and also of The National folks' productionI feel like my fandom for both respective artists is justifiedI hope Matt Berninger is having a good day
― whiney hoosteen (flamboyant goon tie included), Friday, 24 July 2020 11:03 (six years ago)
don’t know if anyone’s talked about “peace” yet, but...wow, “peace”
― monotony, Friday, 24 July 2020 11:10 (six years ago)
I like the pastoral home-movie clips that accompany each track on the Spotify phone app. They help to set the mood.
― mike t-diva, Friday, 24 July 2020 11:24 (six years ago)
Peace was the one that set me off, tears forming in my eyes. What a great album
― boxedjoy, Friday, 24 July 2020 11:55 (six years ago)
so "The Last American Dynasty" is her less starstruck "Starlight" crossed with "Showbiz Kids," no?
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 12:00 (six years ago)
God, yes, me too on "Peace" - that one really stopped me in my tracks, a heart-stopping tear-jerker.
― mike t-diva, Friday, 24 July 2020 12:04 (six years ago)
xp last american dynasty immediately reminded me of starlight yeah
― johnny crunch, Friday, 24 July 2020 12:40 (six years ago)
This might be the first Swift album I'm excited to hear, but I'm also curious to see if it passes the teen test. That is, will my actual bonafide teen girls like and listen to it. My older one never really got into the last couple of Swift albums, but my younger one really liked the last one, I think partly based on how much she liked the documentary.
― Josh in Chicago, Friday, 24 July 2020 13:04 (six years ago)
um "Cardigan" is really really beautiful
― Joey Corona (Euler), Friday, 24 July 2020 13:13 (six years ago)
xp Josh in Chicago does Dark Souls pass the teen test?
― Joey Corona (Euler), Friday, 24 July 2020 13:14 (six years ago)
I also bought one right of the bat at midnight. Turns out I purchased the non-explicit one, how the f**k was I supposed to know this would be the first TS release with profanities in in the middle of this whole frenzy and chaos.
― cpl593H, Friday, 24 July 2020 13:15 (six years ago)
I'm loving it, surely up to the standards of Lover, not sure yet if it surpasses it. I like the understatement of "conventional" Taylor, her subtleties and nuances hidden in plain sight. I'm afraid media will spin the "artistic statement" side of this to the point of exhaustion but in the long run this will pass, the songs will remain and it'll still be great.
For the time being, Speak Now > Lover/folklore > Red > Fearless > 1989 > rep > TS
― cpl593H, Friday, 24 July 2020 13:21 (six years ago)
hearing her swear is funny imo
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 13:21 (six years ago)
I'm liking this a lot already. What's the term people use? "Tryhard?" So far this sounds much less try hard than her last few, imo. Just more relaxed, really pushing her strengths to the fore, perfect summer melancholia. Or at least perfect for *this* summer.
Older teen thinks it's really pretty so far, which it is. Younger teen was already listening to it, too, and her first take was "I like it, it's a lot more like her older stuff, before she went pop star."
― Josh in Chicago, Friday, 24 July 2020 13:23 (six years ago)
Dark Souls does not pass the teen girl test, but that game was a great way to get them out of the room.
― Josh in Chicago, Friday, 24 July 2020 13:24 (six years ago)
'this is me trying' is the most beautiful song ever.
― Nourry, Friday, 24 July 2020 13:35 (six years ago)
No. "Cardigan" is.
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 13:36 (six years ago)
I haven't listened to the album; I have only listened to/watched the video for "Cardigan." Does it sound like an LDR song to anyone else?
― but also fuck you (unperson), Friday, 24 July 2020 13:44 (six years ago)
yes
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 13:45 (six years ago)
for some reason LDR can hold my attention for an hour of dirges where Taylor can't, tho
This seems much less dirgy than LDR to me.
― Josh in Chicago, Friday, 24 July 2020 13:48 (six years ago)
"Cardigan" is a little more revved-up than LDR, but the structure/rhyme scheme feels similar to me, and it almost sounds like Swift is singing in a slightly lower register than usual, but that may be my relative ignorance of her catalog talking.
― but also fuck you (unperson), Friday, 24 July 2020 13:50 (six years ago)
sounds like she's been listening to Hatchie...
― Number None, Friday, 24 July 2020 13:52 (six years ago)
― k*r*n koltrane (Simon H.), Friday, July 24, 2020 6:45 AM (seven minutes ago) bookmarkflaglink
you're playing yourself here
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 13:54 (six years ago)
if I knew how to play anyone else I would!
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 13:55 (six years ago)
take it to the gay thread, sailor
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 13:55 (six years ago)
i don't really hear ldr but maybe that's because the piano parts on this are soooo national-y (for the obvious reason) so that's all i can think about
― ufo, Friday, 24 July 2020 13:58 (six years ago)
again, i understand that taylor is obsessed with ldr, but my mind immediately skips to references beyond her e.g. ... tori, "seven" even manages to have a kind of sarah mclachlan feel. feel like ldr would never make a record this lilith fair imo. which is not me dissing ldr but is def me praising this album
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:01 (six years ago)
also to ufo's point, some of these songs would sound exactly like national songs with berninger singing over them. taylor manages to take them somewhere else though
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:02 (six years ago)
ldr would never make a record this lilith fair
dangerous to say this so close to her long-dreaded spoken word release
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 14:04 (six years ago)
I've never heard the National or Tori Amos. So I'll trust Brad on those affinities.
― but also fuck you (unperson), Friday, 24 July 2020 14:05 (six years ago)
Brad otm there. A lot of these songs, you can totally hear the National, but listening to Swift sing then really underscores what she brings to the table. And Berninger, too, respectively.
― Josh in Chicago, Friday, 24 July 2020 14:07 (six years ago)
rather spookily this and I am Easy to Find are both 16 tracks and almost exactly the same length
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 14:08 (six years ago)
I don't hear LDR much; there's a lightness of being with which TS is imbued even at her most introspective.
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 14:10 (six years ago)
not a band i'd compare the sound of the record to at all, but the verses of "the 1" are *very* the 1975
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:11 (six years ago)
lol i hear it
― ufo, Friday, 24 July 2020 14:12 (six years ago)
I had this dream you're doing cool shitHaving adventures on your ownYou meet some woman on the internet and take her home
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:15 (six years ago)
the lyrics on this record are so fucking GOOD which is another reason i can't compare it to ldr
their lyrical approaches have almost nothing in common but I'll stop myself there lol
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 14:18 (six years ago)
sorry 4 giving in to the irresistible diss simon
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:20 (six years ago)
if I was going to get upset I wouldn't love utterly dissable artists
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 14:22 (six years ago)
I know I'm obsessed with The 1975, but the beginning of 'mirrorball' is almost exactly the same as The 1975's 'medicine'.
― Nourry, Friday, 24 July 2020 14:39 (six years ago)
I want you to knowI'm a mirrorballI can change everything about me to fit inYou are not like the regularsThe masquerade revelersDrunk as they watch my shattered edges glisten
fuckin slaps!!!!
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:42 (six years ago)
The overall mood definitely feels Lilith Fair without sounding a lot like anyone in particular, tho the piano production does evoke Sarah Mclachlan (more than Tori, I think, whose piano attack is sharper). Also obviously all the '70s women-piano-pop that Lilith Fair itself evoked, Carole King and Carly Simon etc.
And agreed about the lyrics. One of my FB friends just complimented the gauche/goes slant rhyme. I've always liked the craftsman side of Taylor, the obvious pleasure she gets in putting things together just the way she wants them.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 14:46 (six years ago)
lovely, mature album with especially vivid lyrics for swift. generally liked the Antonoff tracks more than the Dessner ones (and I'm a National fan, though more in the 00s than the 10s). early favorites are "Mirrorball" and "Epiphany" - both have really gauzy, light production that elevate swift in a way that feels like new territory for her, though maybe bits of 1989 sounded like this?
― Indexed, Friday, 24 July 2020 14:46 (six years ago)
Hmm, I typically can't stand Swift's music but I may check this out based on the Sarah McLachlan comparisons.
― pomenitul, Friday, 24 July 2020 14:48 (six years ago)
"mirrorball" is like a more self-aware "enchanted," like it has all the same totally-gone falling-for-someone swoonings but it's also like "what am i doing, am i losing myself in trying so hard to appeal to this person and reflect their interests?"
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:49 (six years ago)
though maybe bits of 1989 sounded like this?
― Indexed, Friday, July 24, 2020 7:46 AM (three minutes ago) bookmarkflaglink
i was expecting this record to sound like "safe & sound" but, surprisingly, "this love" seems to be the actual touchstone
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:50 (six years ago)
I was gonna say "Clean," but yeah.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 14:52 (six years ago)
it can be both!!!!
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:52 (six years ago)
every time i look up the lyrics to one of these songs i see a line or a verse that kicks my ass. all of "seven" is amazing, the second verse is i think trying to portray a greater adult darkness as viewed from the eyes of a child, cf. "i think your house is haunted / your dad is always mad and that must be why / and i think you should come live with me / and we can be pirates / then you won't have to cry," which is staggering on its *own*, and then the bridge is
please picture me in the weedsbefore i learned civilityi used to scream ferociouslyany time i wanted
fuck
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 14:55 (six years ago)
Kinda sad about matty because he had come up with the "taylor nebraska" whole thing in an interview and how he would be glad to produce it and now this thing comes up and that box has obviously been ticked now.
― cpl593H, Friday, 24 July 2020 14:55 (six years ago)
"This love" was great
― cpl593H, Friday, 24 July 2020 14:56 (six years ago)
the lyrics of "this is me trying" are very reputation-y (cf. how "adjusting" rhymes with "rusting") but i really love "i was so ahead of the curve, the curve became a sphere / fell behind all my classmates and i ended up here"
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 15:06 (six years ago)
ha -- I noted that line/image too.
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 15:06 (six years ago)
and i love pretty much every line in "illicit affairs," i think it's just great writing. "what started in beautiful rooms / ends with meetings in parking lots"; "take the words for what they are / a dwindling, mercurial high / a drug that only worked / the first few hundred times"; "and you wanna scream 'don't call me kid, don't call me baby' / look at this godforsaken mess that you made me"
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 15:11 (six years ago)
Do any of you know if she is a reader, or if she's ever recommended or mentioned any books she's reading? I'd be curious.
― Josh in Chicago, Friday, 24 July 2020 15:14 (six years ago)
It's obvious her sense of metaphor has expanded in the last decade, which means she no doubt reads or is at least sponging from the right sources.
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 15:15 (six years ago)
I think a key thing I like about this album was that it *isn't* a "Taylor Nebraska" thing, or rather, that what I kinda figured might be the case -- some sort of vocal/guitar only thing -- wasn't. (And I know that while his pseudo-Walden days were long ago, the announced presence of Bon Iver also had me wondering.) As I muttered I really don't think about the National at all so if this is what they sound like then I'm perfectly content to listen to this rather than them, honestly. Alfred's point about Taylor's 'lightness of being' strikes me, and could also possibly explain why I'd find this much more interesting a prospect all around than the National straight up or LDR, the truest of blank zones. But to get back to the sense of sound beyond all these other points raised -- it's not a 'return' to a past so much as a comfortable shift, one which underscores the argument I've had (in my head only, maybe) for years that 'roots music' is a fetishized and misunderstood concept, given that our collective memories shift more and more to a point where it's been electronically mediated and supported as much as 'really' played by someone.
― Ned Raggett, Friday, 24 July 2020 15:16 (six years ago)
xxp She's a fan of Sally Rooney, which makes sense:https://lithub.com/sally-rooney-is-trending-again-and-this-time-its-because-of-taylor-swift/
― jaymc, Friday, 24 July 2020 15:17 (six years ago)
Yeah the Rooney connection makes sense. They're both very good at taking stock situations -- boy-girl, misunderstanding, mixed feelings, etc. -- and peeling back clichés to get to the underlying messiness.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 15:21 (six years ago)
I am surprised by how much I'm enjoying this album
― shout-out to his family (DJP), Friday, 24 July 2020 15:22 (six years ago)
And speaking of her metaphors, I was just appreciating this one: "You're a flashback in a film reel on the one screen in my town."
You get this sense of her really working to get to the specifics of the feeling.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 15:22 (six years ago)
t's not a 'return' to a past so much as a comfortable shift, one which underscores the argument I've had (in my head only, maybe) for years that 'roots music' is a fetishized and misunderstood concept, given that our collective memories shift more and more to a point where it's been electronically mediated and supported as much as 'really' played by someone.
This is a great point.
If anything, this album reminds me aesthetically -- not sonically -- of something like Blood on the Tracks, on which a decade of rummaging for cool sounds to complement the increasingly sophisticated songwriting strengthens a suite of ostensibly acoustic tunes. Think also of Tunnel of Love or Sleater-Kinney's No Cities to Love.
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 15:25 (six years ago)
a comfortable shift
Yeah, Ned, this that you wrote jumped out at me, too. She adapts so well to this shift it doesn't even sound like an adaptation.
― Josh in Chicago, Friday, 24 July 2020 15:30 (six years ago)
Thanks to you both -- your comparisons there, Alfred, are striking.
― Ned Raggett, Friday, 24 July 2020 15:46 (six years ago)
Yes to the "This Love" comparison
― Indexed, Friday, 24 July 2020 16:06 (six years ago)
didn't read this thread but this is a good album, the first one I've liked since 1989 (ok I never really gave the last one a shot)
― akm, Friday, 24 July 2020 16:21 (six years ago)
This is reminding me a lot of the second half of Rilo Kiley's More Adventurous, right down to the unwelcome vocals of a guy on a solitary track
― boxedjoy, Friday, 24 July 2020 16:37 (six years ago)
So is there an actual Varg connection or…?
― pomenitul, Friday, 24 July 2020 16:37 (six years ago)
similar love of knitwear?
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 16:38 (six years ago)
me after I’ve left the neon lights of the city behind to get back to the land and listen to Folklore, but there’s some part of me that just can’t let go of who I used to be pic.twitter.com/nxzWsgRP0e— Sam Lansky (@samlansky) July 24, 2020
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Friday, 24 July 2020 16:49 (six years ago)
Still see this poster hanging in public libraries:
https://www.walden.com/wp-content/uploads/2014/06/taylor-swift-768-1.jpg
― "...And the Gods Socially Distanced" (C. Grisso/McCain), Friday, 24 July 2020 17:22 (six years ago)
can someone shop White Fragility in there
― k*r*n koltrane (Simon H.), Friday, 24 July 2020 17:22 (six years ago)
Women like hunting witches tooDoing your dirtiest work for you too
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 17:34 (six years ago)
tbh She's in the movie version of "The Giver," so there's a bit of what's good for the goose in there. And to go full tin-hat, that was at the end of the promotional cycle for "Red," and seeing her in a bright red dress with bright red lipstick next to the word "READ" kills a few more birds with one stone too. She's a clever one, that Taylor Swift.
― Josh in Chicago, Friday, 24 July 2020 17:36 (six years ago)
i cannOT stop crying to "mirrorball"
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 17:50 (six years ago)
think a key thing I like about this album was that it *isn't* a "Taylor Nebraska" thing
Yeah, it's not really a Taylor Nebraska! But it checks all the marks Healy seemed to suggest when he mentioned the concept.
― cpl593H, Friday, 24 July 2020 18:11 (six years ago)
I'd be interested in seeing more of those pop star library posters. I know the one with Bowie is totally classic.
― cpl593H, Friday, 24 July 2020 18:12 (six years ago)
I had the R.E.M. one for a while:
https://www.hakes.com/Image/MediumRes/96585/1/image.jpg
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 18:15 (six years ago)
(mine was not signed, it was taped slightly askew on my door room wall)
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 18:16 (six years ago)
xp I remember seeing that Healy comment at the time and thinking, "You can't really produce a Nebraska for someone else; if you want Taylor to make a Nebraska you'll just have to find some way to lock her in her house for a year with a guitar and a harmonica."
― Lily Dale, Friday, 24 July 2020 18:16 (six years ago)
Just ordered the vinyl and they were like "this ships in 16 fucking weeks", which is kinda perfect because although yes, this is a melancholy summer album, it will slot in really nicely with my fall and winter and winter favorites as well.
― peace, man, Friday, 24 July 2020 18:23 (six years ago)
just saw a headline declaring this "the perfect quar album," and now I have a new abbreviation to loathe
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 18:29 (six years ago)
idk I think it's kinda cool
― the quar on drugs (Simon H.), Friday, 24 July 2020 18:30 (six years ago)
weren't Quar the worst band of all time at one point
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 18:32 (six years ago)
This Taylort Earth
― peace, man, Friday, 24 July 2020 18:33 (six years ago)
'fraid of the 'rona, gotta quar
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 18:35 (six years ago)
james is totally a girl btw
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 19:00 (six years ago)
pretty good album but man, it's kind of a bummer, isn't it? like i'm trying to get ready for the weekend and now i'm kind of sad.
― call all destroyer, Friday, 24 July 2020 19:01 (six years ago)
Yeah - it's both very good, and not the kind of territory that I think I will want to revisit too often.
(btw - the vocal melody at the beginning of "Seven" reminds me of Big Thief's "Cattails.")
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 19:08 (six years ago)
It's not outright depressing, it's more like sweetly melancholic, which of course makes it even worse.
― cpl593H, Friday, 24 July 2020 19:09 (six years ago)
I hadn't looked up which tracks Antonoff worked on, but when that final section of "August" hits - like, he may as well have signed it in Sharpie.
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 19:17 (six years ago)
xp: I listened to it twice this morning and it inspired me to listen to more sad albums. So I reached for Get Lonely and this is kinda a rough way to usher in the weekend.
― peace, man, Friday, 24 July 2020 19:21 (six years ago)
Definitely overshot my target.
― peace, man, Friday, 24 July 2020 19:27 (six years ago)
Once you get deep into the stretch starting with Track 9, it feels like any sense of momentum has been lost.
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 19:35 (six years ago)
idk "invisible string" is track 11, it's pretty buoyant
but also it's a sustained mood, the momentum is by nature unhurried throughout, patient and observational in a way that a late injection of energy would absolutely undermine
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 19:39 (six years ago)
the sequencing makes me feel like i'm wandering through some feverish cloudy interzone that connects all the regions of these songs, her best sequencing ever incidentally
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 19:40 (six years ago)
I do like "Invisible String" a lot. But the 2nd half of the album hits me as a bunch of slow, pretty songs strung together, without enough variation; maybe I'm just not in the right headspace for that mood.
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 19:42 (six years ago)
(or it worked better on a Thursday night than a Friday morning)
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 19:43 (six years ago)
"it's obvious that wanting me dead has really brought you two together" - lyric of the decade
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 19:44 (six years ago)
i get it, part of me keeps starting the record over again after i hit "august," mostly because i want to hear "the 1" all the time. but i really value how much of this album takes place in a unified sonic world because hybrid-country-pop and post-country taylor swift only made one other album like that and it's reputation xp
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 19:47 (six years ago)
long suite of slow atmospheric songs is a feature it shares with the last national record too so it's possible i prepared myself for this by falling really hard for i am easy to find. but though they're the same length taylor's record feels shorter
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 19:48 (six years ago)
Sounds like this is her Sea Change.
― pomenitul, Friday, 24 July 2020 19:50 (six years ago)
oh dear lord no
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 19:50 (six years ago)
The last National album is the only one in their storied catalog I loved, in part because of crucial female support.
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 19:51 (six years ago)
i'm enjoying this v much. if i was going thru a breakup this album would be a real kick in the nuts
― Its big ball chunky time (Jimmy The Mod Awaits The Return Of His Beloved), Friday, 24 July 2020 20:35 (six years ago)
So apparently “Cardigan”, “August” and “Betty” are all about the same situation from the different perspectives of the people involved?
― Tim F, Friday, 24 July 2020 20:45 (six years ago)
That's what I learned from Wilson and Rosen's reviews
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 20:46 (six years ago)
So, how many sleeves did Led Zeppelin have for "In through the out door"?
― Mark G, Friday, 24 July 2020 20:47 (six years ago)
gonna listen to this now and record my feelings here rather than that 'dis hyped' thread
to this end i am only going to record positive feelings
― imago, Friday, 24 July 2020 20:49 (six years ago)
One more "sounds-like" note – that poster of R.E.M. c. 1990 was serendipitous, as the orchestral stretch of "August" from around 3:30 - 3:45 has a few totally Out of Time touches.
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 20:49 (six years ago)
At the very beginning of March, Justin Vernon and I had gone to Texas to work on the new Big Red Machine album. I had been living with my family in France as COVID was starting to spiral out of control in Europe. I said to my wife that maybe they should come back to the States with me because I was worried about getting separated. So we got tickets, and my kids and wife flew to [the family’s home in] Upstate New York and I flew to Texas. I was there for a week, and by the time I got back Upstate, the borders were being shut and we got stuck. I have the Long Pond studio here, so in a way it was lucky.I hunkered down here and started to write a ton of music—more than I ever have. I thought maybe they were National or Big Red Machine ideas or maybe something totally different. Things were happening.So when (Taylor) reached out, I had this large folder of ideas that were pretty well on their way. She was very clear that she didn’t want me to edit any of my ideas; she wanted to hear everything that was interesting to me at this moment, including really odd, experimental noise. So I made a folder of stuff, including some pretty out-there sketches. A few hours later, she sent “Cardigan,” fully written in a voice memo. That’s when I realized that this was unusual—just the focus and clarity of her ideas. It was pretty astonishing. Over the next couple months, this would just happen; all of a sudden, I’d get a voice memo. And then another. Eventually, it was so inspiring that I wrote more ideas that were specifically in response to what she was writing.
I hunkered down here and started to write a ton of music—more than I ever have. I thought maybe they were National or Big Red Machine ideas or maybe something totally different. Things were happening.
So when (Taylor) reached out, I had this large folder of ideas that were pretty well on their way. She was very clear that she didn’t want me to edit any of my ideas; she wanted to hear everything that was interesting to me at this moment, including really odd, experimental noise. So I made a folder of stuff, including some pretty out-there sketches. A few hours later, she sent “Cardigan,” fully written in a voice memo. That’s when I realized that this was unusual—just the focus and clarity of her ideas. It was pretty astonishing. Over the next couple months, this would just happen; all of a sudden, I’d get a voice memo. And then another. Eventually, it was so inspiring that I wrote more ideas that were specifically in response to what she was writing.
https://pitchfork.com/news/the-nationals-aaron-dessner-talks-taylor-swifts-new-album-folklore/
― Indexed, Friday, 24 July 2020 20:54 (six years ago)
is it positive to say that my problems with this so far aren't really to do with swift herself so much as her producers
― imago, Friday, 24 July 2020 21:02 (six years ago)
that is v much my feeling as well fwiw
― the quar on drugs (Simon H.), Friday, 24 July 2020 21:04 (six years ago)
That's funny, her past few albums I blamed the producers for bringing out the stuff I liked least about Swift herself.
― Josh in Chicago, Friday, 24 July 2020 21:07 (six years ago)
Lover was kind of engagingly knockabout at least imo!
― imago, Friday, 24 July 2020 21:08 (six years ago)
literally do not understand anyone's issues with the production
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 21:09 (six years ago)
unless they're bored
i am already pre-annoyed from the rym discussion tho
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 21:11 (six years ago)
The guitar in “The Last Great American Dynasty” is so beautiful.
― Tim F, Friday, 24 July 2020 21:15 (six years ago)
I can't think offhand of a time someone upped their game by getting The National or Bon Iver involved. certainly it didn't improve Kathleen Edwards or Sharon van Etten's tunes, just made them more pointlessly "atmospheric" to their detriment
― the quar on drugs (Simon H.), Friday, 24 July 2020 21:16 (six years ago)
that said if she stays pals with Vernon I hope he passes on BJ Burton's deets at some point
― the quar on drugs (Simon H.), Friday, 24 July 2020 21:18 (six years ago)
I said to Brad to that i hope the Vernon link leads to some work with Jenn Wasner.
― Tim F, Friday, 24 July 2020 21:22 (six years ago)
yeah don't let these boring men write your music, listen to your critic friends and recruit weyes blood lol
― imago, Friday, 24 July 2020 21:22 (six years ago)
re: other folk from this yearI loved the Christian Lee Hutson record (produced by Phoebe Bridgers)https://www.youtube.com/watch?v=2Lg1-xTV4xk
― DJI, Friday, 24 July 2020 21:22 (six years ago)
this gonna be rep stans listening to folklore pic.twitter.com/9jbFxLwuJQ— george (@ursogeorgeous) July 23, 2020
― Tim F, Friday, 24 July 2020 21:24 (six years ago)
also if you're going to do a big major-label melodramatic response to strange times then do it like The 1975 imo: crazed, desperate, ambitious, bursting with nonsense and barely logical. when is taytay gonna lose it properly i ask? when will she release her 'piece of me'? (no, 'look what you made me do' was not it)
this album feels safe, just in a way we haven't really seen from her before, and i think the fault is this studied, my-first-echoey-sad-indie production
positivity! 'august' is actually p good. 'this is me trying' is also decent. i think in future i will listen to this album from track 8 onward haha
― imago, Friday, 24 July 2020 21:25 (six years ago)
The 1975 album is pretty much a logical extension of their previous work though? The extra fragmented-ness is just a question of degree.
― Tim F, Friday, 24 July 2020 21:32 (six years ago)
i have actually really rather liked it from 'august' onward, 'invisible string' probably best track so far, absolutely no accounting for why
― imago, Friday, 24 July 2020 21:33 (six years ago)
u horrible lot will say it took me 8 tracks to acclimatise but i genuinely think the melodies & sonics have got better
― imago, Friday, 24 July 2020 21:34 (six years ago)
Leaving aside the inevitable critical framing, this album doesn’t feel like it’s even trying to be bold or dangerous or risky except from a “what does this mean career wise” perspective (and even then it could easily be framed as a pandemic one-off), and if that’s specifically what a listener is hoping for from Taylor then I suspect they will be disappointed.
In this regard, the point of comparison I keep coming back to is Tori Amos’s ‘Scarlet’s Walk’ - another superficially “safe” album where the ‘sharper’ piano attack referred to above softened but also the lyrical approach became less elliptical and more attuned to working up and examining the crevices of recognisable metaphors. But even more than that, the opening up of the viewpoints so that the songs feel part of a dialogue with (sometimes heard, sometimes unheard) other voices and viewpoints. They’re coming to the same space from opposite directions but the end result - songs bursting with specific imagery and detail but relatively straightforward to unpack lyrically, because they’re part of conversations - feels very similar.
Feel a strong simpatico between these songs and stuff like “Amber Waves”, “A Sorta Fairytale”, “Strange”, “Your Cloud” etc.
― Tim F, Friday, 24 July 2020 21:37 (six years ago)
my crackpot theory about this album: frontloaded the more 'immediate' stuff, kept the slower, sadder stuff for later, but actually, the slower sadder stuff was more interesting (to me at least), if we're getting sad taylor i want truly-desolate taylor, not sad-indie taylor
― imago, Friday, 24 July 2020 21:43 (six years ago)
lol sorry to ride roughshod over your much-more-thoughtful and probably accurate theory tho tim
― imago, Friday, 24 July 2020 21:44 (six years ago)
Happy to hear an album from her that isn’t suited for stadiums/choreography — which is why Alfred’s Tunnel of Love comparison fits so well. An artist who plays Wembley not writing for Wembley.
― ... (Eazy), Friday, 24 July 2020 21:47 (six years ago)
cardigan sounds awfully Lana Del Rey-ish.
― Darin, Friday, 24 July 2020 21:50 (six years ago)
But, like, good.
― Ned Raggett, Friday, 24 July 2020 21:55 (six years ago)
brb gonna find a support group for ppl who strongly disliked the first 7 tracks and rly quite liked the last 9, this is too weird
― imago, Friday, 24 July 2020 21:57 (six years ago)
So AOTY ?
― AlXTC from Paris, Friday, 24 July 2020 22:11 (six years ago)
yes i am sure we are all agreed this is aoty
― imago, Friday, 24 July 2020 22:13 (six years ago)
"peace" is sick as hell isn't it lj
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 22:14 (six years ago)
Poll it this fall vs. Fetch The Bolt Cutters.
― ... (Eazy), Friday, 24 July 2020 22:25 (six years ago)
yeah i was surprised 'peace' was rated so low on rym, it makes good use of that weird little alarm tone
second half of this album's production moves away from bon iver and towards...foxing? thinking aloud here haha
― imago, Friday, 24 July 2020 22:26 (six years ago)
Foxing do seem destined for pop star collaborator status
― the quar on drugs (Simon H.), Friday, 24 July 2020 22:28 (six years ago)
maybe it just made me want to hear 'nearer my god' again haha, now there's an album we can all agree on. yeah christ they NEED to work with some stars
― imago, Friday, 24 July 2020 22:29 (six years ago)
Uh
Jessie Ware recorded the album of the year
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 22:49 (six years ago)
This isn on par with Lover and just as overstuffed. I love the songs I love, but I just can't with Long Albums anymore .
― TikTok to the (Alfred, Lord Sotosyn), Friday, 24 July 2020 22:51 (six years ago)
so based on that clip up there - and perhaps there are exceptions - but it sounds like he made tracks and she wrote melodies and lyrics to those tracks? am i reading that wrong?
this album is really good and a bit boring and too long. if it were 11 tracks instead of 16, the boring part would fade away.
― alpine static, Friday, 24 July 2020 22:54 (six years ago)
but it sounds like he made tracks and she wrote melodies and lyrics to those tracks
yes she's been writing this way with producers since 1989
― mellon collie and the infinite bradness (BradNelson), Friday, 24 July 2020 23:04 (six years ago)
I wonder how much that process has then influenced the overall output of her last few albums, including her lyrical approach.
I mean, if someone gives you the bones of the arrangement for “I Forgot That You Existed” or “You Need To Calm Down”, you’re hardly going to turn that into a “Cardigan” or “Epiphany” lyrically.
So in that sense, Taylor’s output may well be strongly contingent on her collaborators, but not in the way people traditionally mean: rather, because her own creative process seems to strongly involve following the lines of possibility afforded by the material she gets from them.
― Tim F, Friday, 24 July 2020 23:14 (six years ago)
i do tire of dessner's approach a little by the end of this, but i have that same problem with nearly every national album (except i am easy to find but that's still longer than it needed to be)
there's nothing even close to a bad track though which is the first in a long time for her. so much better than lover for that alone
― ufo, Friday, 24 July 2020 23:15 (six years ago)
she had production credits on all of lover so i'd assume she was more involved in the arrangements on that than with the dessner tracks on this & her past martin/shellback collaborations
― ufo, Friday, 24 July 2020 23:19 (six years ago)
wish he'd aaron lessner am I right
― the quar on drugs (Simon H.), Friday, 24 July 2020 23:24 (six years ago)
worth noting that this is an overwhelmingly common arrangement
― like, I’m eating an elephant head (katherine), Friday, 24 July 2020 23:29 (six years ago)
"betty" is the track that's closest to being from her nebraska and i would love a whole album of it
― ufo, Friday, 24 July 2020 23:31 (six years ago)
xpost I know. Wasn't saying it isn't.
anyway, it must be totally wild to send off a folder of tracks to Taylor Swift and then weeks later they start coming back with a bunch of words and melodies you never could've expected.
not to mention sending off a folder of things you think of as yours and then when they come back, they're really no longer yours ... they are now Taylor Swift songs. I mean, I know he has collaborated with many people, but in most cases his name makes the headline.
― alpine static, Friday, 24 July 2020 23:38 (six years ago)
This album sent me back to Lover, which I haven't listened to in a long time, and is sounding really good.
― Your dream has symbolic content (morrisp), Friday, 24 July 2020 23:41 (six years ago)
xpost None of this feels much like Nebraska to me at all, but if I had to choose the song that comes closest, it would probably be Seven. This dark story told from the perspective of a child who doesn't understand what she's seeing - seems like new ground for Taylor and I like it. The rest of this seems lyrically like pretty generic TSwift to me. Seven, Illicit Affairs, Invisible String, August and Peace are songs I'll probably listen to again, but to me it feels like a step back from Lover. There's nothing on here that grabs me the way The Archer did.
My problem with Betty and August and Cardigan - the whole high school trio - is that I find Taylor Swift's version of high school really boring. Like a Sarah Dessen YA novel. I really don't care whether Betty and James get back together or not; they'll both be fine, and they'll break up next year when they go to college anyway.
― Lily Dale, Saturday, 25 July 2020 00:21 (six years ago)
I have never thought the subject matter per se of Taylor’s songs was particularly interesting - the topics are primarily useful as a framework for her to stretch herself as a songwriter and performer.
Like, nothing about the relationship story in “All Too Well” is interesting except what the songwriting details (e.g. the Chekhov’s gun device) and the execution/delivery bring to the table.
Which is not to say that “Seven” isn’t a stretch for Taylor - but less, I think, because of the story it tells than because that story then demands a different approach to the storytelling given the narrator’s position necessitates a very specific and oblique approach to the subject matter.
― Tim F, Saturday, 25 July 2020 00:34 (six years ago)
the high school trio is made far more interesting by the queer reading, which i absolutely buy into now
― ufo, Saturday, 25 July 2020 00:37 (six years ago)
Also re album of the year Beyoncé hasn’t done her Afro-futurist thing yet so I will wait for that
― Its big ball chunky time (Jimmy The Mod Awaits The Return Of His Beloved), Saturday, 25 July 2020 04:21 (six years ago)
"Cold was the steel of my ax to grind for the boys who broke my heart / Now I send their babies presents"― Ned Raggett
this line is so good, and also the followup:
"Gold was the color of the leaves when I showed you around Centennial Park / Hell was the journey but it brought me heaven"
― sleeve, Saturday, 25 July 2020 05:58 (six years ago)
Feeling this on a rainy pandemic day.
― Popture, Saturday, 25 July 2020 06:21 (six years ago)
This album is just insanely good
― Tim F, Saturday, 25 July 2020 08:48 (six years ago)
Also anyone who is feeling this should join Brad and I in enjoying the last three Vanessa Carlton albums
― Tim F, Saturday, 25 July 2020 08:49 (six years ago)
lol assuming they are at all similar to this, the last thing I want tbh is three more albums of this right now.
― Josh in Chicago, Saturday, 25 July 2020 12:33 (six years ago)
My tears ricochet <3
― the article don, Saturday, 25 July 2020 12:38 (six years ago)
Btw, an interesting side-discussion I think worth having is the very idea of releasing an album into the void right now. I'm not as up on pop stuff as some/many of you, but I could have sworn a few months ago people were calling the Dua Lipa album basically the smash hit album of the summer by default. Since then there have been some heavy-hitters (critical and/or popular) that have been releasing to wildly varying degrees of success, afaict. There was the Jessie Ware, which is awesome but I don't think she's a household name, at least not in the States. But then there's the Gaga, who *is*, but whose album as far as I can tell missed the landing pad entirely and splashed down in the water. Then there's the Chicks, whose album arrived with some moderate degree of fanfare but who (again, strictly anecdotally) seemed to have made only a modest impression. But this Swift album, which arrived with *no* fanfare, clearly caught everyone's attention in addition to catching them by surprise.
Anyway, there's a good chance none of these acts will be able to tour behind any of these albums any time soon, maybe not for another year at least, and certainly outside of the bounds of the usual promotional cycle, which makes me wonder how long they'll last in everyone's minds after being launched into said void. Does the usual promotional cycle even matter any more? Is it better to release an album now or delay indefinitely? In the case of Swift's album, as I understand it it was written and recorded during the pandemic, which sets it apart from those other albums. Does/did that make a difference? It's a great record regardless, but was she also just really good at reading the room? I wonder if there are a lot of other artists right now weighing their options. Do we wait it out indefinitely or just take the plunge and do something now? Especially with touring (and therefore their most prominent revenue stream) turned off, it's tantamount to just throwing money in a wishing well and seeing what will happen. Billy Eilish is readying something else, right? But I wonder what else this weird year has in store.
― Josh in Chicago, Saturday, 25 July 2020 12:51 (six years ago)
Woke up with "This Is Me Trying" in my head and now want an entire Taylor Swift darkwave album.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Saturday, 25 July 2020 14:24 (six years ago)
There was the Jessie Ware, which is awesome but I don't think she's a household name, at least not in the States. But then there's the Gaga, who *is*, but whose album as far as I can tell missed the landing pad entirely and splashed down in the water.
"Rain on Me" and "Stupid Love" are radio hits, album debuted at #1. I still hear the hits.
― TikTok to the (Alfred, Lord Sotosyn), Saturday, 25 July 2020 14:38 (six years ago)
i've only listened to "cardigan" so far but i'm really glad to see that she's released an album that's not geared in some way for radio. the white stations she's meant to cater to in particular have largely given up on introducing its audience to new music, but she of all people does not need them. artistically, this move also lets her play to her strengths -- i agree with those who've suggested that her high-octane pop material often lacks the flexibility to let her really do her thing lyrically.
― dyl, Saturday, 25 July 2020 17:20 (six years ago)
― Nourry, Friday, July 24, 2020 3:35 PM (yesterday) bookmarkflaglink
I just got that funny feeling in my stomach listening to it, like when something is beautiful that it moves you physically. this album is incredible.
― Joey Corona (Euler), Saturday, 25 July 2020 17:23 (six years ago)
the broader 'teen test' of course is the streaming charts, and for the moment this album seems to be doing significantly better than lover was doing at this point. it's even doing major damage on apple music, a service that serves a pretty rap-centric audience.
― dyl, Saturday, 25 July 2020 17:24 (six years ago)
anyway the numerous comparisons to "this love" upthread have me hopeful, will def give it a full listen soon
― dyl, Saturday, 25 July 2020 17:32 (six years ago)
the devil's in the details but you got a friend in meee
― NAthaniel (cajunsunday), Saturday, 25 July 2020 17:56 (six years ago)
My anecdotal "hit" standard is whether I hear something if I seek it out or not. Dua Lipa, for example, I hear a lot. From my kids and from other places. But Lady Gaga, had I not known she had a new album out I would not have known if she had a new album out.
― Josh in Chicago, Saturday, 25 July 2020 18:02 (six years ago)
Do they not play #1 singles in America then?
― chonky floof (groovypanda), Saturday, 25 July 2020 18:15 (six years ago)
Maybe I hear the wrong radio? Fewer cars driving by?
― Josh in Chicago, Saturday, 25 July 2020 18:17 (six years ago)
^ it sounds too absurd to be real, but yes, legitimately a good number of #1 hits in the us this year will ultimately fail to find a home at radio. this is partly because pop radio is being historically slow to accept new hits but also because of the recent frequency of efforts to hype the charts, which prompted rule changes at billboard that will go into effect soon but have not yet. (and yes, i'd say it's clear that tay's 16 exclusive deluxe physicals is an obvious chart-hyping strategy that i doubt they'd be going forward with if the new rules had already gone into effect, but it's not like she needs it to make a splashy debut.)
― dyl, Saturday, 25 July 2020 18:23 (six years ago)
re: gaga on american radio lately: it's not just you. "stupid love" was briefly accepted pretty widely at radio, but it ran out of steam fast in the sales-and-streams department and it was ultimately dropped from playlists quickly. "rain on me" is doing quite a bit better, but it too seems to be slowing down in its ascent and could also be dropped prematurely.
as i mentioned above, white radio is currently being hyper-conservative wrt which hits it accepts into heavy rotation, and those that it does accept are likely to stay for a pretty long while. because white radio has spent the past several years largely ignoring streaming charts, it overwhelmingly determines what gets played by passive audience research. new would-be hits like "rain on me" will certainly get their chance, but if they don't light up in this audience testing, they'll get dropped so fast it's like they never existed. (incidentally this was the fate that befell numerous taylor swift singles from her past couple of albums.)
― dyl, Saturday, 25 July 2020 18:33 (six years ago)
Rain On Me was pretty much inescapable here in the UK
― chonky floof (groovypanda), Saturday, 25 July 2020 18:38 (six years ago)
thinking about how if cardigan/august/betty is the "same story in different perspective" trio then how "when i felt like i was an old cardigan under someone's bed, you put me on and said i was your favorite" gets colored by the double meaning, how to put someone on also means to lie to them, so what initially seems like a heartwarming lyric on first listen gets twisted when you hear those next songs. james shows up to the party and puts on the cardigan and hopes it's enough, betty knew she'd come back to him but he chased two girls and lost the one. there is tenderness there but she's also aware of what he's done.
you said the way my blue eyes shined put those georgia stars to shame that night. i said, "that's a lie".
― billy, Saturday, 25 July 2020 18:50 (six years ago)
she's in top form all over the album but i think "peace" is kind of the most devastating thing she's ever done
― billy, Saturday, 25 July 2020 18:52 (six years ago)
Even beyond the trio, so many of the songs here (in fact almost all of them) are about how time changes perspectives on events and places them in different lights, which really does feel like a strong connection back to “Tim McGraw” via so much of her best work in the interim.
― Tim F, Saturday, 25 July 2020 20:45 (six years ago)
the delivery on "peace" is absolutely stunning.
― ripersnifle, Saturday, 25 July 2020 21:20 (six years ago)
xp "time, mystical time" yeah
― sleeve, Saturday, 25 July 2020 21:23 (six years ago)
She mastered that right from the get-go. I remember being totally floored by "Fifteen", the way it acknowledged how things feel when you're that age, the way they feel when you look back at them with the passing of time, and the eloquence and precision she had to express it. And she can't have been older than eighteen when she wrote it!
― cpl593H, Sunday, 26 July 2020 00:41 (six years ago)
I've only listened to it one time through, but it seemed every song didn't really do anything until about 2/3rds of the way through. I liked some of it pretty well though, especially August and Illicit Affairs.
― Tōne Locatelli Romano (PBKR), Sunday, 26 July 2020 00:43 (six years ago)
the thing is while this is a little long i don't really know what i'd cut except maybe "mad woman" which isn't even bad, it just doesn't stand out as much
― ufo, Sunday, 26 July 2020 00:53 (six years ago)
I’ve listen to three or four times and still haven’t really taken in the last song, I just run out of steam (kind of hard to imagine the version w/“bonus track”). But I’ll get there.
― Your dream has symbolic content (morrisp), Sunday, 26 July 2020 01:06 (six years ago)
Muttered this on an FB thread today in response to a post from Jody Rosen on "the deftness of her genre hopping" about something I was thinking about earlier today in a similar vein: I was thinking Bowie to an extent but perhaps maybe also Robert Palmer and Linda Ronstadt, both of whom never seem to quite get that same level of appreciation Bowie got on the variety-within-a-pop-context front. Not trying to draw exact comparisons, just that Swift’s career is now long enough and detailed enough that there’s room to place her in that context. (Especially also since, as time progresses and the immediate ‘who is this about’ reaction that seems to linger about many of her songs as they appear fades into the past, everything becomes...more universal? Timeless in a certain way? Others can spell this out more than I.). Alfred followed this up with a good point that her work moves well beyond "autobiographical analysis, the hobbyhorse of journalistic approaches," which strikes me as apt.
― Ned Raggett, Sunday, 26 July 2020 01:10 (six years ago)
Robert Palmer and Linda Ronstadt, both of whom never seem to quite get that same level of appreciation Bowie got on the variety-within-a-pop-context front.
Very simple explanation here; Bowie's magpie-ism registers as "cool"/"arty" to the critic-brain, where Palmer's and Ronstadt's shifts register as "mercenary"/"empty-shell".
― but also fuck you (unperson), Sunday, 26 July 2020 01:24 (six years ago)
Their loss!
― Ned Raggett, Sunday, 26 July 2020 01:26 (six years ago)
she had a marvelous time ruining everything
― mellon collie and the infinite bradness (BradNelson), Sunday, 26 July 2020 01:58 (six years ago)
The proof is irrefuable!
https://media3.giphy.com/media/1447XAXteQjahi/source.gif
― TikTok to the (Alfred, Lord Sotosyn), Sunday, 26 July 2020 02:00 (six years ago)
"exile" is pretty easily my least favorite song here but that bridge is a killer, some peter gabriel/kate bush "don't give up" shit
― mellon collie and the infinite bradness (BradNelson), Sunday, 26 July 2020 02:04 (six years ago)
i don't like the verse in "exile" much at all but that's more than made up by the chorus & especially the bridge
― ufo, Sunday, 26 July 2020 02:07 (six years ago)
but you know instead of reassuring and life-affirming it's about miscommunication and mutual alienation while still feeling yoked to the memory of an old warmth now lost
... like iirc a lot of the record is xp
― mellon collie and the infinite bradness (BradNelson), Sunday, 26 July 2020 02:08 (six years ago)
salt airand the rust on your doori never needed anything more
― mellon collie and the infinite bradness (BradNelson), Sunday, 26 July 2020 02:17 (six years ago)
^^^ love this opening
― Tim F, Sunday, 26 July 2020 02:23 (six years ago)
Your integrity makes me seem smallYou paint dreamscapes on the wall
― TikTok to the (Alfred, Lord Sotosyn), Sunday, 26 July 2020 02:27 (six years ago)
I believe Aaron Dessner when he says what he enjoyed most was the creative partnership, but I wonder at what point in all this he realized, whoa, I’m about to make a shit-ton of money.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Sunday, 26 July 2020 14:40 (six years ago)
I was thinking about that, too. And Justin Vernon, for that matter, who at this point already has several credits with Kanye, Eminem, et al., he must be swimming in it.
So Dessner has never even been in the same room with Swift, right?
― Josh in Chicago, Sunday, 26 July 2020 14:45 (six years ago)
so she says
― TikTok to the (Alfred, Lord Sotosyn), Sunday, 26 July 2020 14:46 (six years ago)
I’m confused by “genre hopping” - all of Taylor Swift’s music seems to exist on a pretty narrow spectrum between pop and country to my ears?
― trapped out the barndo (crüt), Sunday, 26 July 2020 14:55 (six years ago)
The National guys all have several shit-tons of money already, I doubt the thought really took him aback tbf
― Scampidocio (Le Bateau Ivre), Sunday, 26 July 2020 14:56 (six years ago)
― Tim F, Saturday, July 25, 2020 1:49 AM (yesterday) bookmarkflaglink
oh boy otm
― mellon collie and the infinite bradness (BradNelson), Sunday, 26 July 2020 15:01 (six years ago)
I actually have no sense of how rich "band I've heard of but not Taylor Swift level megastar" makes you. If you're in the National, could you just not work for the rest of your life? It's not *that* rich, is it?
― Guayaquil (eephus!), Sunday, 26 July 2020 15:04 (six years ago)
It's like the Chris Rock routine about "rich" vs. "wealthy." The National guys might not even be "rich," but I'm sure they're fine with money. However, I'm willing to bet Dessner potentially makes as much from this album as he's made from the last several National albums and tours combined.
I don't hear any genre hopping with her. I think maybe a better way to put it is how comfortable she's been with at this point a pretty diverse slate of collaborators. That's a testament to her talents (as singer/lyricist) and her personality, which tbh didn't really click with me at all until this album and, in particular, the documentary. She's the through-line but unlike (for example) Bowie or Madonna, she *doesn't * sound like a "musical chameleon," or someone who hops from style to style and image to image. She just sounds like a really sympathetic and sensitive collaborator, attuned to what others are bringing and what she can bring to them.
Playing the most recent National album again. I should play this for my kids to see if they hear any similarities.
― Josh in Chicago, Sunday, 26 July 2020 15:09 (six years ago)
I seriously doubt Dessner has a day job, and I'm sure he does just fine, as he works with many many artists and I'm sure he's paid well for it. He's done a few film scores also but nothing huge. "Rich" I'm not sure but he likely has a comfortable life.
― akm, Sunday, 26 July 2020 15:24 (six years ago)
A day job?! The National has sold millions of records and did p/ much non-stop touring, selling out huge venues (in Europe at least). They're all millionairs, easily.
― Scampidocio (Le Bateau Ivre), Sunday, 26 July 2020 15:36 (six years ago)
Oh sure it’s just that whatever comfortable lifestyle he already has he just got a nice bonus.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Sunday, 26 July 2020 15:38 (six years ago)
Looking at Spotify, just their top 10 songs have had around 400 million streams so I imagine they do ok
― chonky floof (groovypanda), Sunday, 26 July 2020 15:40 (six years ago)
Lol, 400 million streams on Spotify probably gets them a sandwich.
― Josh in Chicago, Sunday, 26 July 2020 15:41 (six years ago)
Touring is expensive. It's very easy to come back from a big headlining tour having barely broken even, or even lost money.
• You have to pay the road crew, tour manager, publicist, etc. out of pocket• Visas, travel expenses, hotels, etc.• Insurance• If you're not a headliner, if you're opening for a major touring act or on a festival tour (Warped, Knotfest, Ozzfest when that was a thing, etc.), you have often bought that slot
I'm sure the National do well, because they've managed to make it a sustainable business for quite a long time, and Dessner does other stuff, but if he's more than upper-middle-class I'd be really shocked. Run of the mill doctors and lawyers make more money in a given year than highly successful, highly recognizable musicians.
― but also fuck you (unperson), Sunday, 26 July 2020 15:44 (six years ago)
Run of the mill doctors and lawyers kindergarten teachers make more money in a given year than highly successful, highly recognizable musicians.
― flamboyant goon tie included, Sunday, 26 July 2020 16:00 (six years ago)
Yeah, seriously. Just to underscore costs, Swift's Reputation tour reportedly made $266 million, which is a ton of money, but Swift herself is worth somewhere around $350 million, which means she got paid piles of money, of course, but that the bulk of the tour money probably went to the machine. Assuming any of these numbers are even close to accurate, in 2018 she reportedly earned $5 million in record sales, $2.4 million through streaming, and $2 million in publishing royalties. I bet she makes the most through endorsements and stuff, though.
Anyway, I was curious. One estimate has it that Spotify pays $1 for every 229 streams. So barring some special secret negotiation, 400 million streams likely gets the National a little under $2 million. Divided across the band members, minus costs, and yeah, you're doing well but not buying a private island or anything. But if Swift made $ 2.4 million in total streaming, then the National probably make much, much less than annually.
― Josh in Chicago, Sunday, 26 July 2020 16:00 (six years ago)
One estimate has it that Spotify pays $1 for every 229 streams. So barring some special secret negotiation, 400 million streams likely gets the National a little under $2 million.
This isn't the thread for this, but a) that seems way higher than I've read elsewhere, and b) Spotify doesn't pay individual artists for how much their music is streamed. A lot of people are very mad about that fact and have been since the beginning. Spotify takes all the money generated by all the songs that are streamed, throws it in a big pot, and divides it up among all the artists and labels.
― but also fuck you (unperson), Sunday, 26 July 2020 16:06 (six years ago)
Oh I'm sure those numbers are totally wrong. Those streaming services are less than transparent at best, and infamously not generous. Didn't Pharrell say that tens of millions of streams of Happy essentially made him peanuts? Point being that 400 million streams seems like a lot, until you realize it pays fractions of a cent per stream.
― Josh in Chicago, Sunday, 26 July 2020 16:12 (six years ago)
Lads. The National are a band who still sell rekkids! Middle-aged people buy their cds and expensive double lp’s. Crazy i know. And yes, touring is expensive, but you’re not telling me a band like that isn’t making good money off those hundreds of thousands 60-90 euros per ticket. Not that it matters but.. Yeah, I don’t think Dessner will be too surprised with what this gig will pay him.
― Scampidocio (Le Bateau Ivre), Sunday, 26 July 2020 16:12 (six years ago)
The National are one of the top five most successful indie bands in USA, they own their own houses. Income primarily comes from plum licenses (in commercials, movies), points on hit records ("Folklore", i.e.) and tour revenue. I'd peg Aaron's take on "Folklore"'s sales/streaming profits, assuming he's making 25%, at an average of 500k a year for the next decade. But: these are musicians in the absolute upper echelon of money-makers. Any lawyer practicing corporate law, real estate law, litigation or claims is gonna be making more per annum than a Dessner
― flamboyant goon tie included, Sunday, 26 July 2020 16:22 (six years ago)
I checked and their delayed Europe tour they had two nights at the O2 Academy Brixton which is 5K capacityI think ilx never gave a fuck about them so you're underestimating how popular they are and how ardent their fanbase is.
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Sunday, 26 July 2020 16:22 (six years ago)
It was really just an offhand thought. Here you are, a member of a successful rock band, puttering around at home during quarantine, making music because that's what you do and you have a lot of time on your hands and you're not even sure what the music's for, and then you get a text message and suddenly it's like, "Oh, that's what this music is for — to buy another couple houses and stage my long-dreamt-of puppet musical on a mountain in Norway."
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Sunday, 26 July 2020 16:24 (six years ago)
You're thinking of Phil Elverum
― flamboyant goon tie included, Sunday, 26 July 2020 16:30 (six years ago)
I like Ned's most recent posts-- although I feel as if Taylor kind of hit her "Let's Dance" phase a little early.
― flamboyant goon tie included, Sunday, 26 July 2020 16:35 (six years ago)
Thanks! A little early, maybe, but also I might take relative age and 'career' space into account. (Eight years separate the debut album and 1989, eleven years separate Ziggy Stardust and Let's Dance -- and yes, I know that's not when Bowie started etc. etc. but let's phrase it in terms of the US public eye, and also the difference in how careers work now, as such.)
― Ned Raggett, Sunday, 26 July 2020 16:41 (six years ago)
I mean, in between those glam rock and pop albums, he did soul pastiche, ambient collaborations with Eno, art-rock with Fripp,... Do people really see a remotely comparable scope in Taylor Swift's work? Like crut, I am also baffled by "genre hopping" wrt TS.
― Feel a million filaments (Sund4r), Sunday, 26 July 2020 17:02 (six years ago)
The album she did with Wolfgang Voight was admittedly pretty unexpected.
― Josh in Chicago, Sunday, 26 July 2020 17:04 (six years ago)
I think "Peace" (on the new album) may have the most "soul" of any song Taylor has done?
― Your dream has symbolic content (morrisp), Sunday, 26 July 2020 17:07 (six years ago)
(Great song, btw - probably should have ended the album? I still can't get into "Hoax," or ever really hear the melody.)
― Your dream has symbolic content (morrisp), Sunday, 26 July 2020 17:15 (six years ago)
i see that this thread is gonna get to 1000 comments before i get a chance to listen
― Fuck the NRA (ulysses), Sunday, 26 July 2020 17:34 (six years ago)
Yeah sund4r you're kinda right-- less in common with a Robert Palmer and more in common with "a rock band who had their disco moment". I hope that's the case, anyway! I have no taste for Taylor-the-pop-musician. I like her best when she sounds like Jann Arden
― flamboyant goon tie included, Sunday, 26 July 2020 17:46 (six years ago)
i'm two listens in, + tho i'm enjoying it i'm also not sure if my interest will sustain for much beyond that. it's very nice and a smart/refreshing departure for her, but it is also so ceaselessly subdued in mood that i do struggle to take it all in as an ~album~ at times. the instrumentation is polite and refined, for better and worse, + i enjoy the hypnotic electronic touches. i found myself wishing that the hazy instrumental opening to "epiphany" would just continue uninterrupted for awhile like a stars of the lid record or something but nope, had to jump right back into tay's vocals. unlikely to become my fav ts record, but pretty good!
i enthusiastically welcome her not releasing a tragic, labored attempt at a 'pop hit' prior to dropping the album
― dyl, Sunday, 26 July 2020 19:05 (six years ago)
have personally been wondering if the subdued mood is a feature and not a bug. i look at what's working on streaming and i don't see a lot of big/bombastic/uptempo/maximalist pop music
i see sad ballads from the pop artists who do manage to fit through the bottleneck and reach the masses, and i see songs that are advance scouts from rap and r&b records that in a lot of ways, resemble folklore more than they resemble reputation or 1989. long, tonally melancholy/subdued, lyrically focused at least compared to the max martin school of "if it sounds good, who cares what it means?"
the single that worked from lover was the title track. the single that worked from reputation was delicate. either of those songs could show up on folklore and fit right in. what if this just is the sound of pop now? what if the smaller, more subtle gradient of moods this record displays from track to track are just more relatable and enticing to a generation of listeners that isn't interested in the traditional sugar rush of bubblegum because they literally have cut actual sugar out of their actual diets and therefore mistrust any product, cultural or otherwise, that's trying to give them too much too soon?
― jaime b., Sunday, 26 July 2020 19:20 (six years ago)
screaming at the thought of this album's tracks getting slotted into the popular 'peaceful piano' 'mood' playlists
― dyl, Sunday, 26 July 2020 19:35 (six years ago)
sounding more depressed/pensive does not automatically make your music more sophisticated or subtle. imo that this is swift's best album is nothing to do with the (admittedly au courant) glumness or mood greydient and more to do with the fact that it feels less dead-eyed than usual & she (eventually) starts doing more interesting things with the instrumentals than before. it's reductive to say that pop music itself is becoming less maximalist. pop music is becoming more of everything and you can choose to listen to whatever bits of it you're told to you like
― imago, Sunday, 26 July 2020 19:40 (six years ago)
All fair, but this is also her first album in four albums not preceded by a particularly obnoxious, very not subtle lead single. Definitely a choice.
― Josh in Chicago, Sunday, 26 July 2020 19:52 (six years ago)
“Shake It Off” wasn’t obnoxious (and neither was “We Are Never...,” if you’re counting back that far). This is veering into “pop is bad” territory!
― Your dream has symbolic content (morrisp), Sunday, 26 July 2020 20:00 (six years ago)
I mean, different strokes, I guess.
― Josh in Chicago, Sunday, 26 July 2020 20:02 (six years ago)
shake it off was foully obnoxious, we are never was iconic, rip terrace house
― imago, Sunday, 26 July 2020 20:10 (six years ago)
"we are never" was the last decent one, it was all sharply downhill from there leading to the unmitigated abomination that is "me!"
― dyl, Sunday, 26 July 2020 20:45 (six years ago)
i assume "look what you made me do" hasn't come up bc it's the best lead single of those three albums and it's great
― mellon collie and the infinite bradness (BradNelson), Sunday, 26 July 2020 20:57 (six years ago)
i fully admit i was not read for the taylor swift heel turn at the time and now i think it's so campy and arch and delightful
― mellon collie and the infinite bradness (BradNelson), Sunday, 26 July 2020 21:07 (six years ago)
i was not ready*
― mellon collie and the infinite bradness (BradNelson), Sunday, 26 July 2020 21:08 (six years ago)
arch(er)
― TikTok to the (Alfred, Lord Sotosyn), Sunday, 26 July 2020 21:11 (six years ago)
Yeah, whatever you think LWYMMD was, laboured attempted at an obnoxious pop hit doesn’t seem like a good description.
“Shake It Off” and “Me!” are really the only two - in both cases they don’t even seem to fit in with the rest of the album that produced them.
― Tim F, Sunday, 26 July 2020 21:18 (six years ago)
I remember being on a date the first time I heard "Shake it Off" and immediately knowing I'd hear it several hundred more times whether I liked it or not
― the quar on drugs (Simon H.), Sunday, 26 July 2020 21:19 (six years ago)
i still don't think lwymmd was good but it's at least entertaining and the video really helped sell it
"shake it off" isn't bad but also not at all good either. "me!" on the other hand is one of the worst things she's ever done
― ufo, Sunday, 26 July 2020 21:32 (six years ago)
imo "cardigan" is a bad choice for first single and it would have been a massive error to drop it in advance of the album rather than on the same day
we live in a world where the post-LDR sadcore continuum is producing monster chart hits like "someone you loved", and "cardigan" to me feels just as targeted towards mainstream trends as "me!" felt targeted at pop radio playlists during the era of "high hopes" and the jonas brothers
― jaime b., Sunday, 26 July 2020 21:37 (six years ago)
ah the "look what you made me do" video........ cinema
― mellon collie and the infinite bradness (BradNelson), Sunday, 26 July 2020 21:41 (six years ago)
what would have been a better lead single from it though, "exile"? "cardigan" seems like as good as it gets as far as lead single choices go here
― ufo, Sunday, 26 July 2020 22:15 (six years ago)
yes it really had to be a choice between two of the worst songs on the album
― imago, Sunday, 26 July 2020 22:22 (six years ago)
"cardigan" is great and "exile" at least has a fantastic bridge
― ufo, Sunday, 26 July 2020 22:28 (six years ago)
Yeah, actually, "We are Never ..." has grown on me.
― Josh in Chicago, Sunday, 26 July 2020 23:20 (six years ago)
I really like Exile and I say that as someone who has been deeply allergic to Bon Iver for virtually his entire career. Would love to hear an entire album of duets, in that vein (as opposed to the godawful Brendon Urie vein).
― Evans on Hammond (evol j), Sunday, 26 July 2020 23:28 (six years ago)
I don't care for that song or like the Bon Iver records much, but he has a good voice and I'm not mad when he shows up in things (eg the Hadestown studio album, Bonny Light Horseman, Yeezus)
― the quar on drugs (Simon H.), Sunday, 26 July 2020 23:31 (six years ago)
surely monsieur iver will be duetting with tay at whichever grammy ceremony this album will be competing in
― dyl, Sunday, 26 July 2020 23:43 (six years ago)
grammy wouldn't be the same without albums like taylor or bomb ivor in them
― imago, Sunday, 26 July 2020 23:54 (six years ago)
bon (h)iver? more like mauvais été, amirite?
― Your dream has symbolic content (morrisp), Monday, 27 July 2020 00:02 (six years ago)
c'est vrai
― dyl, Monday, 27 July 2020 00:05 (six years ago)
― the quar on drugs (Simon H.), Sunday, 26 July 2020 23:31 (yesterday) link
One of the upshots of Hadestown is that I wasn't at all surprised to hear him sing in baritone.
I bet Taylor would just love that album if she heard it.
― Tim F, Monday, 27 July 2020 00:13 (six years ago)
I still listen to it more than the Broadway cast album tbh. "If It's True", fuck.
― the quar on drugs (Simon H.), Monday, 27 July 2020 00:38 (six years ago)
that does also make me wonder if she likes/has heard Anais Mitchell actually
Oh yeah it's much better IMO, even if the Broadway cast album adds a lot of good songs. I think there's an interconnection of the personal and the mythical on a lot of the songs ("If It's True" yeah, but also stuff like "Wedding Song" and "Flowers") that really chimes in with some of the songwriting on Folklore - which the duet on "Exile" drives home, but it's not the only example.
Re Anais more generally, songs like "Your Fonder Heart" or "Any Way The Wind Blows" are very Taylor-esque in parts.
― Tim F, Monday, 27 July 2020 00:47 (six years ago)
Actually the (non-Hadestown) song that really underscores the connection is "Namesake".
― Tim F, Monday, 27 July 2020 01:01 (six years ago)
I believe Lover and Reputation would've been received much better as albums if she'd released them suddenly and all at once like she has with this one. She bungled the release of those ones with terrible first single choices and cringy marketing campaigns, and this ultimately impacted how they were received as projects. I do think this album is better than both of those, but the fact that it has pretty much forced people to accept it as a complete project helps it. It's interesting, it really does feel like Taylor is really still pulling for the idea of the ALBUM as the ultimate unit of musical consumption when the rest of the music culture feels like it's pulling strongly against it. It seems somewhat conservative or traditional in the present environment, but I like that. I think this album, which feels like a collection of thematically linked short stories to me, is a good example of being able to do things over the course of a record that can't be just done in one song.
― triggercut, Monday, 27 July 2020 03:29 (six years ago)
Taylor's pretty lucky that official greatest hits compilations are no longer a thing - if she had one it would be a total mess.
― Tim F, Monday, 27 July 2020 04:55 (six years ago)
This album is as boring as a Bon Iver album.
― wasdnous (abanana), Monday, 27 July 2020 10:27 (six years ago)
CTRL+F Paysage D'Hiver
0 results!
― StanM, Monday, 27 July 2020 14:25 (six years ago)
Wait that's why I would like it.
― Ned Raggett, Monday, 27 July 2020 14:30 (six years ago)
Anyway Jill Mapes wrote a positive review for Pitchfork that wasn't 10.0 and so logically she's been trashed by stans for hours.
― Ned Raggett, Monday, 27 July 2020 14:32 (six years ago)
Yeah it's kinda being discussed in the stan thread
― Scampidocio (Le Bateau Ivre), Monday, 27 July 2020 14:33 (six years ago)
Been through the album a few times now and even though I quite like some of the Dessner tunes, the Antonoff songs (My Tears, Mirrorball, Seven, August, This is Me Trying, Illicit Affairs, Betty) are so much more thrilling, and sure feels like the two could have made something really really special together.
Also, fans have noticed some parallel images with the film Portrait of a Lady on Fire:
Taylor really said “that film has a very sad ending but it’s art, I think I will put references about it” #folklore pic.twitter.com/5Cepig4gWY— ELIZA(betty) (@YeeHawSwiftie) July 26, 2020
― Indexed, Monday, 27 July 2020 14:40 (six years ago)
Seven is a Dessner one I think
― chonky floof (groovypanda), Monday, 27 July 2020 14:51 (six years ago)
You're right - was thinking Antonoff did that whole middle block.
― Indexed, Monday, 27 July 2020 14:54 (six years ago)
I like how “the 1” keeps basically the same repetitive piano figure through the whole song, and the entire melody and structure comes just through the vocal lines. It’s a nice stripped down illustration of her writing style.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Monday, 27 July 2020 15:05 (six years ago)
and it builds impressively
― TikTok to the (Alfred, Lord Sotosyn), Monday, 27 July 2020 15:06 (six years ago)
She loves her crescendos.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Monday, 27 July 2020 15:13 (six years ago)
working on “taylor swift phrases” pic.twitter.com/hOfK2H0nxY— Julie Greiner (@JulieAbridged) July 26, 2020
― DJI, Monday, 27 July 2020 16:40 (six years ago)
― Larry Elleison (rogermexico.), Monday, 27 July 2020 16:47 (six years ago)
Ned Fucking Raggett!
― the quar on drugs (Simon H.), Monday, 27 July 2020 16:50 (six years ago)
ahah
― AlXTC from Paris, Monday, 27 July 2020 16:51 (six years ago)
That would have been a great ILX cover project !
― AlXTC from Paris, Monday, 27 July 2020 16:52 (six years ago)
wait, which thread is the stan thread?
― alpine static, Monday, 27 July 2020 17:29 (six years ago)
"peace" sounds like a Bon Iver song
― Indexed, Monday, 27 July 2020 17:31 (six years ago)
I wonder what brought her to Dessner? And/or what she would have done had he not had a stack of songs and sketches and ideas ready to send her way that she immediately responded to. Related, I wonder how wide a net she cast looking for collaborators and ideas. I assume it couldn't have just been Dessner, there must have been others now bound by NDAs (or maybe slated for future projects?).
This was pretty interesting (if it hasn't been posted yet):
https://www.vulture.com/2020/07/taylor-swift-folklore-aaron-dessner-breaks-down-every-song.html
Then there's all this (intentionally?) mysterious stuff about William Bowery, who gets two credits on the record but maybe contributed more and maybe is a pseudonym. I've seen her boyfriend Joe Alwyn and Harry Styles mentioned as possibilities. I think Harry Styles is a good guess, since he and Swift reportedly worked on some unreleased music in the past, and maybe they went with a pseudonym to get around label conflicts. But who knows.
― Josh in Chicago, Monday, 27 July 2020 17:43 (six years ago)
"william bowery" definitely a harry styles-ass pseudonym
― the quar on drugs (Simon H.), Monday, 27 July 2020 17:44 (six years ago)
William Bowery is who Harry Styles is when he's on 'shrooms.
― "...And the Gods Socially Distanced" (C. Grisso/McCain), Monday, 27 July 2020 18:27 (six years ago)
Ned Fucking Raggett!― the quar on drugs (Simon H.), Monday, July 27, 2020 9:50 AM (one hour ago)ahah― AlXTC from Paris, Monday, July 27, 2020 9:51 AM (one hour ago)That would have been a great ILX cover project !― AlXTC from Paris, Monday, July 27, 2020 9:52 AM (one hour ago)
― the quar on drugs (Simon H.), Monday, July 27, 2020 9:50 AM (one hour ago)
― AlXTC from Paris, Monday, July 27, 2020 9:51 AM (one hour ago)
― AlXTC from Paris, Monday, July 27, 2020 9:52 AM (one hour ago)
A vision, it's true.
― Ned Raggett, Monday, 27 July 2020 18:31 (six years ago)
QED xps
https://exilehaylor.tumblr.com/post/624764980399669248/william-bowery-is-harry-styles
― chonky floof (groovypanda), Monday, 27 July 2020 18:38 (six years ago)
Heh. A lot of that is one step above "Harry Styles is a person, William Bowery is a person, ergo, Harry Styles is William Bowery."
― Josh in Chicago, Monday, 27 July 2020 18:43 (six years ago)
if you rearrange the letters in "william bowery" you get "bowie willamry". harry styles is a known fan of bowie and "williamry" sounds like "william"
― the quar on drugs (Simon H.), Monday, 27 July 2020 18:47 (six years ago)
there is/was a music critic named William Bowers, right? maybe it's him being lazy with the pseudonymns.
― Evans on Hammond (evol j), Monday, 27 July 2020 19:36 (six years ago)
William Bowery = Bill Bowery = Bowery Bill = Bill the Butcher = Daniel Day-Lewis = Paul Thomas Anderson = Aimee Mann
Puzzle solved.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Monday, 27 July 2020 20:15 (six years ago)
and you guessed it, Aimee "Mann" = noted "man", Harry Styles
― the quar on drugs (Simon H.), Monday, 27 July 2020 20:16 (six years ago)
if she were a manthen she'd be a Mann
― TikTok to the (Alfred, Lord Sotosyn), Monday, 27 July 2020 20:17 (six years ago)
lol
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Monday, 27 July 2020 20:18 (six years ago)
I did think of the character Daniel Day-Lewis played in Gangs of New York tbh.
― Sonny Shamrock (Tom D.), Monday, 27 July 2020 20:24 (six years ago)
― the quar on drugs (Simon H.), Monday, July 27, 2020 11:50 AM (three hours ago) bookmarkflaglink
YOU WANTED THE BEST - YOU GOT THE BEST!!!
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Monday, 27 July 2020 20:32 (six years ago)
exilehaylor dot tumblr dot com
― dyl, Monday, 27 July 2020 20:41 (six years ago)
isn't it just so pretty to think: all along, there was some invisible string tying you to meEEeEEeEEeEEeeeee
― winters (josh), Tuesday, 28 July 2020 03:02 (six years ago)
meeEEeeEEeeEEeeEEeeeeeeee• to a 16th note pace -- can't notate letters and put them on a staff, unfortunately
― winters (josh), Tuesday, 28 July 2020 04:44 (six years ago)
OKAY -- I spent my evening re-sequencing the tracklist, and I'm so happy with it that I really am bummed it isn't the actual tracklist you can get on vinyl because it sounds like a bonafide classic to me this way (seriously not trying to pat myself on the back), and it feels so good to fall in love with this music:
1. epiphany2. mirrorball3. august4. invisible string5. betty6. the last great american dynasty7. illicit affairs8. cardigan9. hoax10. seven11. mad woman12. exile (ft. Bon Iver)13. this is me trying14. my tears ricochet15. peace16. the 1
― winters (josh), Tuesday, 28 July 2020 06:30 (six years ago)
i'm still trying to suss out how i feel about this overall, but it strikes me as a far more honest record than lover, which has some great songs as always but just feels clumsy and distracted as a full body of work. there's some resonant writing on lover but nothing w/ the emotional clarity and power of songs on here like "peace" or "invisible string". i mean compare "invisible string" which has obvious autobiographical elements but is more just a beautiful & broadly applicable song about having a soulmate to "london boy"... lol.
i'm not a fan of the national, and aside from a few bon iver things that whole scene has never really grabbed my attention. in my heart of hearts i still feel like there is better production out there for her -- ok fine i just want her version of 'the weight of these wings' -- but there's some really interesting and surprising textural elements on this record that have never really been present in her collaborations w/ pop producers even dating all the way back, so that's cool. the beginning of the album especially is rewarding as a headphones record.
if we draw a line in the sand after red, i still think reputation is my favorite... i think she really channeled the villainy that has always run alongside her public persona in a powerful way & just came up w/ an awesome pop record save for a few clunkers. but this is a good pivot for her and really has some knockout songs. i think there's a pastoral element -- that final third of 1989, LDR-ness about it -- that keeps me at a bit of a distance. but this is a better path for her to follow than working w/ frank dukes & louis bell. she isn't going to win at the pop game right now and as the initial response to this record on streaming shows, doesn't even need to.
― J0rdan S., Tuesday, 28 July 2020 08:05 (six years ago)
ok fine i just want her version of 'the weight of these wings'― J0rdan S., Tuesday, July 28, 2020 3:05 AM (six hours ago) bookmarkflaglink
― J0rdan S., Tuesday, July 28, 2020 3:05 AM (six hours ago) bookmarkflaglink
This would be fun, though hard for me to imagine her doing something as ragged as "Ugly Lights" or as classic as "To Learn Her." I'd love to see her do something more akin to Golden Hour.
― Indexed, Tuesday, 28 July 2020 15:01 (six years ago)
would love to hear the song taylor swift writes after dropping acid
― mellon collie and the infinite bradness (BradNelson), Tuesday, 28 July 2020 15:03 (six years ago)
― J0rdan S., Tuesday, July 28, 2020 4:05 AM (seven hours ago) bookmarkflaglink
Fully agree
― gonzo84d, Tuesday, 28 July 2020 15:37 (six years ago)
this might be the record that gets me into taylor swift. wish i could still buy new cds lol
― Give me a Chad Smith-type feel (map), Tuesday, 28 July 2020 15:51 (six years ago)
I really liked Bon Iver's first album but found everything else he's done pleasant but slightly unmemorable; like, I really enjoyed listening to the last album of his, but can't recall a single song. But I like his contribution here a lot and I like that song, though, someone I know pointed out something about about the lyrics that made me think 'yeah, this is kind of an unsettling metaphor right now'. I'm assuming TS knows that and this is an attempt to turn nationalist tropes on their head, but singing about homeland is always a bit dicey.
― akm, Tuesday, 28 July 2020 16:32 (six years ago)
There isn't a single album which wouldn't be improved by a couple of omissions, this one no exception; but I like Lover as much as the best songs on this one.
― TikTok to the (Alfred, Lord Sotosyn), Tuesday, 28 July 2020 16:33 (six years ago)
i should go back and relisten to that album; I think I gave it one shot and something annoyed me and I never went back.
― akm, Tuesday, 28 July 2020 16:38 (six years ago)
"Cruel Summer" is top ten Taylor in my caon
― TikTok to the (Alfred, Lord Sotosyn), Tuesday, 28 July 2020 16:41 (six years ago)
*canon
"Cruel Summer" is the real keeper for me from Lover, if I'm just playing one song from it.
I like the live versions of "London Boy" I've heard (thinking especially of the BBC Live Lounge version) but I skip the album version.
― Joey Corona (Euler), Tuesday, 28 July 2020 16:58 (six years ago)
There isn't a single album which wouldn't be improved by a couple of omissions, this one no exception; but I like Lover as much as the best songs on this one.― TikTok to the (Alfred, Lord Sotosyn), Tuesday, July 28, 2020 11:33 AM (fifty-four minutes ago) bookmarkflaglink
― TikTok to the (Alfred, Lord Sotosyn), Tuesday, July 28, 2020 11:33 AM (fifty-four minutes ago) bookmarkflaglink
The s/t is pretty tight, no?
― Indexed, Tuesday, 28 July 2020 17:29 (six years ago)
my favorite song on this album is “peace” because it sounds like frank ocean “solo” and i’m not ashamed of that fact at all
― J0rdan S., Tuesday, 28 July 2020 17:51 (six years ago)
xpcurious if Alfred was talking just about TS or in general there
― rob, Tuesday, 28 July 2020 18:05 (six years ago)
― Indexed, Tuesday, 28 July 2020 18:11 (six years ago)
my favorite song at the moment is "august" -- it's "oh my god I can't believe music can be this impossibly beautiful and perfect" to me
― winters (josh), Tuesday, 28 July 2020 19:44 (six years ago)
I think "Exile" is awesome. Would I like other Bon Iver stuff(?)
― Your dream has symbolic content (morrisp), Tuesday, 28 July 2020 22:15 (six years ago)
"Exile" makes me wish Vernon had just sung in his lower register his whole career, maybe I would've had another artist I like for the past decade.
― alpine static, Tuesday, 28 July 2020 22:34 (six years ago)
yeah you'd probably like his albums; try the "For Emma" or the s/t
― akm, Tuesday, 28 July 2020 23:25 (six years ago)
cool, I'll give it a shot
― Your dream has symbolic content (morrisp), Tuesday, 28 July 2020 23:51 (six years ago)
― Larry Elleison (rogermexico.), Wednesday, 29 July 2020 02:18 (six years ago)
Crooked Fingers is hella underrated
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Wednesday, 29 July 2020 03:20 (six years ago)
this piece made me realize something that should have been obvious, which is that we clearly have a serious deficit of actual queer pop stars
― the quar on drugs (Simon H.), Wednesday, 29 July 2020 03:59 (six years ago)
xpost oh i love Bachmann
― alpine static, Wednesday, 29 July 2020 06:43 (six years ago)
Taylor Swift’s ‘betty’ is Queer Canon. I Don’t Make the Rules.this style of headline writing makes me want to die
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Wednesday, 29 July 2020 14:41 (six years ago)
Millennial Writing Style Is SLAYING X'ers and NO ONE Cares
― Fuck the NRA (ulysses), Wednesday, 29 July 2020 14:44 (six years ago)
whenever I find this person who Made The Rules they're going to get a real talking to
― the quar on drugs (Simon H.), Wednesday, 29 July 2020 14:47 (six years ago)
yeah that sort of breathless basic fawning is so unseemly
also there are plenty of queer people making great pop, they just don't become stars very often
― imago, Wednesday, 29 July 2020 14:54 (six years ago)
Taylor Swift’s ‘betty’ is Queer Canon. I Don’t Make the Rules.
Such erudite etymological wordplay.
― pomenitul, Wednesday, 29 July 2020 14:57 (six years ago)
xp yeah that was an odd comment? Like there's more well-known and out young, queer pop musicians right now than maybe any other time in history? Lil Nas X, King Princess, Troye Sivan, Frank Ocean, Hayley Kiyoko all come to mind without a google search. Not suggesting that's cause for a "yay, systemic pop homophobia is over" but the arguable issue in swift's case is moreso that - same as it ever was - it's chic for straight presenting artists to co-opt queer culture/sensibilities... but i haven't heard the album yet so i dunno if that's what she's even doing.
― Fuck the NRA (ulysses), Wednesday, 29 July 2020 15:02 (six years ago)
chic and if you'll permit a slice of trenchant social commentary, lucrative
― imago, Wednesday, 29 July 2020 15:06 (six years ago)
but i haven't heard the album yet so i dunno if that's what she's even doing
it's a projection based on the characters being named after blake lively's daughters
i know i prefer to think of the narrative as queer but i'd never insist on it and i guess taylor swift wouldn't either
― mellon collie and the infinite bradness (BradNelson), Wednesday, 29 July 2020 15:11 (six years ago)
but the arguable issue in swift's case is moreso that - same as it ever was - it's chic for straight presenting artists to co-opt queer culture/sensibilities... but i haven't heard the album yet so i dunno if that's what she's even doing.
tbc I do not think she is doing this! there are definitely clicks to be gotten by straining to include her in "the queer canon" tho. and I do think if there were more queer pop stars who were anywhere near her popularity level, ppl wouldn't be able to get away with that take. or they'd at least have a rougher go of it.
― the quar on drugs (Simon H.), Wednesday, 29 July 2020 15:11 (six years ago)
Sam Smith is another obvious one.
― jaymc, Wednesday, 29 July 2020 15:12 (six years ago)
and of course also tbc I should have absolutely no say or influence on what goes in that "canon" I just found this instance funny xp
― the quar on drugs (Simon H.), Wednesday, 29 July 2020 15:13 (six years ago)
imo what's really annoying about that headline is not capitalizing "is," which is a verb
― rob, Wednesday, 29 July 2020 15:15 (six years ago)
a lot of the initial push to read the triptych as a queer, sapphic love story has, in my estimation, come from kaylors who have oriented their lives around the theory that taylor swift is closeted
― mellon collie and the infinite bradness (BradNelson), Wednesday, 29 July 2020 15:16 (six years ago)
what's a "kaylor"?
― rob, Wednesday, 29 July 2020 15:17 (six years ago)
you know maybe it's better if i don't explain that
― mellon collie and the infinite bradness (BradNelson), Wednesday, 29 July 2020 15:18 (six years ago)
(stans who believe karlie kloss and taylor swift were romantically involved)
https://www.theringer.com/music/2017/11/9/16625462/taylor-swift-karlie-kloss-kaylor-tumblr-shipping
― Fuck the NRA (ulysses), Wednesday, 29 July 2020 15:19 (six years ago)
thanks! figured it was a 'ship, but I have never heard of Kloss before
― rob, Wednesday, 29 July 2020 15:20 (six years ago)
but also if taylor swift actually wrote a song suite about three women in love, that's totally awesome 2 me
― mellon collie and the infinite bradness (BradNelson), Wednesday, 29 July 2020 15:25 (six years ago)
hard to feel co-opted when a great writer is making a high school love triangle feel emotionally vivid and complex to me
― mellon collie and the infinite bradness (BradNelson), Wednesday, 29 July 2020 15:26 (six years ago)
I'm assuming TS knows that and this is an attempt to turn nationalist tropes on their head, but singing about homeland is always a bit dicey.― akm, Tuesday, 28 July 2020 16:32 (yesterday) link
― akm, Tuesday, 28 July 2020 16:32 (yesterday) link
when i listened to this for the first time i definitely assumed it was about her breaking up with america rather than just a dude, and bon iver blurting "so step right out!" was the voice of all the conservatives who turned on her after she starting being vocal about politics. i like the song fine but i like it more this way than just as a "the last time" redux
yesterday the enjambment in the first verse of "seven" really fucked me up
― billy, Wednesday, 29 July 2020 15:45 (six years ago)
this is definitely the kind of knowledge that, upon gaining it, wipes something more useful out of your brain
― the quar on drugs (Simon H.), Wednesday, 29 July 2020 15:46 (six years ago)
singing about homeland is always a bit dicey.IMO it’s a better line for the metaphor than any alternative I can think of — “You’re not my country anymore”? My “nation”? Those don’t really work for a relationship (which can actually feel like a “homeland”).
― Your dream has symbolic content (morrisp), Wednesday, 29 July 2020 16:15 (six years ago)
"polycule" would have been more au courant
― the quar on drugs (Simon H.), Wednesday, 29 July 2020 16:18 (six years ago)
The clunky metaphor is actually the next line — “You were my town, now I’m in exile...”“Town” is weak; something like “home” would be better, but she already said “homeland.”
― Your dream has symbolic content (morrisp), Wednesday, 29 July 2020 16:20 (six years ago)
(clunky metaphors are kind of her thing, though)
― Your dream has symbolic content (morrisp), Wednesday, 29 July 2020 16:21 (six years ago)
Whoever annotates the Genius.com entries for Taylor Swift songs has an annoying tendency of flagging lyrics just to point out very slight similarities with lyrics from previous songs of hers (like, literally, a repeated word).
― Your dream has symbolic content (morrisp), Wednesday, 29 July 2020 16:31 (six years ago)
Yeah, I saw some of those notations last night, those drive me nuts.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Wednesday, 29 July 2020 17:05 (six years ago)
i feel like i've learned something about myself vis a vis taylor bcuz every time i listen to "invisible string" my mind expects her to say "isn't it just so funny to think / all along there was some invisible string / tying you to me?" instead of "isn't it just so pretty"
― J0rdan S., Wednesday, 29 July 2020 18:59 (six years ago)
'hoax' is so devastating and may have become my favourite taylor swift song. her closers are always sick but this is the first one that's completely devoid of hopefulness or optimism
"you knew it still hurts underneath my scars from when they pulled me apart - but what you did was just as dark" ;_;
― überweiss, Wednesday, 29 July 2020 19:18 (six years ago)
“Isn’t it pretty to think” recalls the closing line of The Sun Also Rises, no?
― Joey Corona (Euler), Wednesday, 29 July 2020 19:19 (six years ago)
you're right:
Isn't it pretty to think that the sun...also rises?
― the quar on drugs (Simon H.), Wednesday, 29 July 2020 19:20 (six years ago)
I agree with this. High points in Lover are as high as the best tracks here, and the stretch in the middle is as good as folklore or Red. On the other hand, I think folklore comes out on top because even if you could remove a couple tracks here to improve it, I can't find anything that makes you want to skip here; no cringe tracks. And I have nothing against her cringy stuff, I enjoy them the same way I appreciate the most idiotic McCartney stuff; but this album feels stronger without them.
― cpl593H, Thursday, 30 July 2020 15:58 (six years ago)
I'm not sure if it was intentional or not, but I'm getting some really pleasant R.E.M. vibes here, esp. w/"Illicit affairs" (I'm thinking of the likes of "Half a world away")
― cpl593H, Thursday, 30 July 2020 15:59 (six years ago)
I like the way "Illicit Affairs" doesn't resolve, musically or narratively. It goes into the bridge and never comes back.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Thursday, 30 July 2020 16:20 (six years ago)
Has anybody seen the bridge?
― TikTok to the (Alfred, Lord Sotosyn), Thursday, 30 July 2020 16:36 (six years ago)
someone call phoebe
― the quar on drugs (Simon H.), Thursday, 30 July 2020 16:39 (six years ago)
Bridgers to Babylon
― TikTok to the (Alfred, Lord Sotosyn), Thursday, 30 July 2020 16:42 (six years ago)
I suspect Swift might be more into "Bridge to Terabithia."
― Josh in Chicago, Thursday, 30 July 2020 16:43 (six years ago)
That might be the harshest thing anyone has ever said about Taylor Swift.
― Lily Dale, Thursday, 30 July 2020 17:04 (six years ago)
I like the album a lot, but JFC she is milking her fans with these staggered merch and single drops. I mean, obviously no one has to buy all of this shit, but I genuinely feel bad for these young stans that are feeling pressured to buy everything to show their support.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Thursday, 30 July 2020 17:10 (six years ago)
I really liked the cardigan ¯\_(ツ)_/¯
― cpl593H, Thursday, 30 July 2020 17:20 (six years ago)
this is always the strangest moment of the new Taylor Swift album thread
― a morley steve vai bad horsie what? (Sufjan Grafton), Thursday, 30 July 2020 18:52 (six years ago)
Bridge to Terabithia was my favorite book in elementary school because I'm never not hovering over the surface of my deep emotions, so I have been feeling deeply validated by this album
― winters (josh), Thursday, 30 July 2020 20:44 (six years ago)
Hopefully someday there will be an ILM Taylor tracks poll so I can vote for "invisible string"
― bunny slopes, Thursday, 30 July 2020 21:05 (six years ago)
I just accidentally closed my mp3 player app while playing invisible string and it was living death.
― cpl593H, Thursday, 30 July 2020 21:30 (six years ago)
https://www.thedailybeast.com/taylor-swift-remains-silent-as-fans-doxx-and-harass-music-critic-over-folkore-review
― sleeve, Friday, 31 July 2020 02:09 (six years ago)
that Tapes n' Tapes album did getba better score
― a morley steve vai bad horsie what? (Sufjan Grafton), Friday, 31 July 2020 02:16 (six years ago)
Menomena, too
I assume I'm in a very small club when I say I miss Menomena
― the quar on drugs (Simon H.), Friday, 31 July 2020 02:19 (six years ago)
Guillemots
― a morley steve vai bad horsie what? (Sufjan Grafton), Friday, 31 July 2020 02:20 (six years ago)
I heard what turned out to be Invisible String randomly, really like it a lot! Heard another one I didn't like so I'll stick with just this track for now and try another in a couple of weeks
― saer, Friday, 31 July 2020 03:46 (six years ago)
a couple of mit grads made an algorithm that tells you "if you liked 'Invisible String', listen to 'peace' next"
― a morley steve vai bad horsie what? (Sufjan Grafton), Friday, 31 July 2020 03:54 (six years ago)
I didn’t realize that doxxing/harassment was going on. Why doesn’t she say something?
― Rob, give a listen to Iggy Stooge (morrisp), Friday, 31 July 2020 03:58 (six years ago)
maybe she's upset that two Architecture in Helsinki albums got higher scores
― a morley steve vai bad horsie what? (Sufjan Grafton), Friday, 31 July 2020 04:04 (six years ago)
the cardigan demo really highlights the vocal melodies and performance in a nice way. Must have been too dark in that cabin to find the vocal mic's gain slider, though.
― a morley steve vai bad horsie what? (Sufjan Grafton), Friday, 31 July 2020 04:17 (six years ago)
also makes the album version's percussion feel like a tortured production choice that takes me out of it a bit now.
― a morley steve vai bad horsie what? (Sufjan Grafton), Friday, 31 July 2020 04:20 (six years ago)
...or too busy tracking down Architecture In Helsinki for a collaboration on her next quarantine album.
― "...And the Gods Socially Distanced" (C. Grisso/McCain), Friday, 31 July 2020 05:25 (six years ago)
where's the cardigan demo?
― ufo, Friday, 31 July 2020 05:30 (six years ago)
it is a single on spotify, and I assume elsewhere. Called "cabin in candlelight version."
― a morley steve vai bad horsie what? (Sufjan Grafton), Friday, 31 July 2020 05:59 (six years ago)
We made an all acoustic, stripped down version of #Cardigan yesterday. Have a listen! https://t.co/sUZyj1WLRp— Aaron Dessner (@aaron_dessner) July 30, 2020
i think it's just an alternate mix, not the demo. the piano & vocal take sounds the same as the album version, so the only new addition to the mix is the acoustic guitar.
i like the album version's percussion, it adds to the ways it reminds me of tori
― ufo, Friday, 31 July 2020 06:13 (six years ago)
ah ok. I googled it while listening and nme.com calls it a demo. I've been lied to.
― a morley steve vai bad horsie what? (Sufjan Grafton), Friday, 31 July 2020 06:35 (six years ago)
i've heard "cardigan" on the radio several times now and to my surprise it never sounded out of place
― dyl, Sunday, 2 August 2020 22:48 (six years ago)
A "remix/mashup" of Mirrorball and This Is Me Trying, tagged as #Shoegaze. Probably closer to Noise Pop due to the blown-out nature of the mix. Pretty cool.
https://soundcloud.com/stpaulattheendoftheworld/mirror-trying-remix-mashup-of-taylor-swift-mirrorball-this-is-me-trying
― Skrot Montague, Saturday, 8 August 2020 00:18 (five years ago)
This album is so precisely my shit. Just killer track after killer track. Giving me a lot of mid-90s lo-fi indie vibes, Scrawl in particular. I don't think she's ever written better melodies or let herself just consistently stretch out like this. And when she has in the past the lyrics have always felt a bit cloying, like overcompensating or showy, and now its just so goddamn seamless. This is now up in competition with any of the classic singer-songwriter albums from the 70s or whatever. I absolutely didn't expect we could ever have chart-topping albums like this ever again.
― Hakim Bae's TMZ (s.clover), Friday, 14 August 2020 01:48 (five years ago)
even the "bad" ones have grown on me
― it's a spicy dinner we're having (Sufjan Grafton), Friday, 14 August 2020 02:08 (five years ago)
also how tf did the whole conversation about "cardigan" revolve around ldr and not like early fiona apple? (and there's a lot of half-quotes of "wildest dreams" too)
― Hakim Bae's TMZ (s.clover), Friday, 14 August 2020 02:43 (five years ago)
the other comparison that came up apart from ldr wrt "cardigan" was tori amos which i agree with far more
― ufo, Friday, 14 August 2020 03:06 (five years ago)
um, Scrawl vibes?! guess I will listen to this after all
― geoffreyess, Friday, 14 August 2020 03:16 (five years ago)
hmmm but scrawl were good
― unpaid intern at the darvo institute (Simon H.), Friday, 14 August 2020 03:18 (five years ago)
I played this a lot those first few days, but haven’t been compelled to revisit it. I guess each album of hers (since Red) has had less staying power for me than the one preceding it.
― Get your filthy hands off my asp (morrisp), Friday, 14 August 2020 03:58 (five years ago)
I very much enjoyed relistening to this tonight although yeah you could cut 3-4 songs easy
― sleeve, Friday, 14 August 2020 05:30 (five years ago)
I resequenced the album and it made me love it a lot more
― winters (josh), Friday, 14 August 2020 06:22 (five years ago)
there's a natural flow to the songs on this album that isn't the official track listing, and it serves to highlight the songs that make up the album much more
― winters (josh), Friday, 14 August 2020 06:23 (five years ago)
without having to cut any songs if you don't want to -- it's definitely a slow burn of an album
josh post the sequence
― unpaid intern at the darvo institute (Simon H.), Friday, 14 August 2020 06:47 (five years ago)
here's my sequence! it sounds like a proper adventure through the wilderness with peaks and valleys along the way -- starts out slow and sunny, slowly shifts into sepia and somber, moves through those tones, then eventually finds some clearing at the end.
it may be helpful to view this sequencing in the LP format -- Side A: 1-4; Side B: 5-8; Side C: 9-12; Side D: 13-16
― winters (josh), Friday, 14 August 2020 13:06 (five years ago)
i guess i shouldn't be surprised that ppl here are driven to resequence the best-sequenced taylor swift record since fearless but... whet?????? "the 1" last???? no way
― mellon collie and the infinite bradness (BradNelson), Friday, 14 August 2020 13:16 (five years ago)
i mean not to knock the adventure you've created josh, it looks like a fun listen!
― mellon collie and the infinite bradness (BradNelson), Friday, 14 August 2020 13:19 (five years ago)
yeah there's nothing wrong with the sequence at all and i think her sequencing has usually been kinda dubious at best.
― ufo, Friday, 14 August 2020 13:21 (five years ago)
ha no big! we're all just having fun here
― winters (josh), Friday, 14 August 2020 13:32 (five years ago)
guess it's just indicative of how I listen to music
― winters (josh), Friday, 14 August 2020 13:35 (five years ago)
"the 1" last????
You should hear my "Wish" resequence that starts with "End" and ends with "Open." Totally changes your perspective, makes you think! No wonder Robert Smith is struggling with the remaster.
― Josh in Chicago, Friday, 14 August 2020 13:35 (five years ago)
(I can totally imagine resequencing "Folklore." Tbh, I doubt there are many 70 minute, 17-song albums that couldn't be successfully shuffled.)
― Josh in Chicago, Friday, 14 August 2020 13:37 (five years ago)
I should try a resequence, like josh's, because my attention runs out of steam by the last three songs, which I'll probably love should I be more receptive to listening to them carefully
― Joey Corona (Euler), Friday, 14 August 2020 13:39 (five years ago)
Whoever mentioned Scrawl in this thread, thanks! I don’t hear this album at all but I discovered a band I’d never heard of and immediately like
― a hoy hoy, Friday, 14 August 2020 20:59 (five years ago)
awesome, Scrawl are great
― sleeve, Friday, 14 August 2020 21:55 (five years ago)
travel on rider is dope
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Friday, 14 August 2020 22:01 (five years ago)
bonus track "the lakes" is now available to hear: https://www.youtube.com/watch?v=tOHcAc3r2kw
― monotony, Tuesday, 18 August 2020 07:39 (five years ago)
not bad but the album is definitely better without it
― ufo, Tuesday, 18 August 2020 08:42 (five years ago)
I woke up with "Mirrorball" and "The 1" in my head, a lovely way to wake up.
― TikTok to the (Alfred, Lord Sotosyn), Tuesday, 18 August 2020 10:07 (five years ago)
"the lakes" is fine but a song that references twitter would strike a false note on the album
― mellon collie and the infinite bradness (BradNelson), Tuesday, 18 August 2020 14:54 (five years ago)
No song that alludes to Wordsworth and Coleridge can't be a bad song.
― TikTok to the (Alfred, Lord Sotosyn), Tuesday, 18 August 2020 14:55 (five years ago)
uh lol can be a bad song
i want auroras and sad prosei want to watch wisteria grow right over my bare feetbecause i haven't moved in years
― mellon collie and the infinite bradness (BradNelson), Tuesday, 18 August 2020 15:12 (five years ago)
actually when i heard "the lakes" last month i immediately thought of it as a decoder for the rest of folklore, it sets the intentions
― mellon collie and the infinite bradness (BradNelson), Tuesday, 18 August 2020 15:14 (five years ago)
The album's now split into EP-size chunks ("the escapism chapter," "the sleepless nights chapter")?
― “Pizza House!” (morrisp), Tuesday, 25 August 2020 03:41 (five years ago)
This is definitely the 2020 album on top of 'recently' in spotify that I just gravitate towards and end up listening to even when I've entered with different intentions
― abcfsk, Tuesday, 25 August 2020 07:23 (five years ago)
It goes well with anything — brunch, cocktails, late nights. The perfect 2020 lifestyle accessory album, which I mean in a good way.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Tuesday, 25 August 2020 16:02 (five years ago)
No song that alludes to Wordsworth and Coleridge can't be a bad song.uh lol can be a bad song
Agree that Genesis's "The Colony of Slippermen", Rush's "Xanadu", and Iron Maiden's "Rime of the Ancient Mariner" are classic.
― The nexus of the crisis and the origin of storms (Sund4r), Tuesday, 25 August 2020 16:16 (five years ago)
otm
― TikTok to the (Alfred, Lord Sotosyn), Tuesday, 25 August 2020 16:39 (five years ago)
\m/
― The nexus of the crisis and the origin of storms (Sund4r), Tuesday, 25 August 2020 16:49 (five years ago)
I Designed A Taylor Swift Theme Park w/60+ Attractions!
― Josh in Chicago, Thursday, 27 August 2020 19:30 (five years ago)
https://www.youtube.com/watch?v=pno5g88MONo
(That was a C&P error, I didn't design this, lol)
― Josh in Chicago, Thursday, 27 August 2020 19:31 (five years ago)
taking stannery to a whole new level..... I admire his Virgo mastermind energy
― winters (josh), Monday, 31 August 2020 04:25 (five years ago)
this is the best movie of 2020 — his love of her music is so sweet and sincere
― winters (josh), Monday, 31 August 2020 04:40 (five years ago)
For anyone who care, here is how those aforementioned "EPs" break down:
folklore: the saltbox house chapterlast great american dynastyaugustthe 1seven peacebetty
folklore: the sleepless nights chapterexile (feat. Bon Iver)hoaxmy tears ricochetillicit affairsthis is me tryingmad woman
folklore: the escapism chapterthe lakessevenepiphanycardiganmirrorballexile (feat. Bon Iver)
It's weird that "Exile" appears twice? Or maybe not weird, I'm sure there's some logic behind it.
― “Pizza House!” (morrisp), Wednesday, 2 September 2020 19:27 (five years ago)
Probably wanted to make it an even 6 for each EP, but only had 17 songs to work with. Also throwing some more streaming change at her buddy Mr. Iver.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Wednesday, 2 September 2020 19:29 (five years ago)
Good song to repeat, IMO
― “Pizza House!” (morrisp), Wednesday, 2 September 2020 19:32 (five years ago)
("Seven" is also repeated, fwiw)
Listening thru these EPs, I don't feel like the track order is an "improvement" in how they present the songs - I would stick with the album running order.
― “Pizza House!” (morrisp), Wednesday, 2 September 2020 20:14 (five years ago)
I missed something ... is this "three EPs" thing something Taylor has put forth? or is it just a fan theory kind of thing?
― alpine static, Wednesday, 2 September 2020 20:16 (five years ago)
Seems to be official - they're on the streaming services (as her "latest releases"). I haven't seen them discussed anywhere, but I also haven't looked.
― “Pizza House!” (morrisp), Wednesday, 2 September 2020 20:17 (five years ago)
Taylor herself tweeted out these tracklists, so they are official in that sense. Cynically, just a way to keep goosing the streaming numbers now that the album has been out for awhile.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Wednesday, 2 September 2020 20:36 (five years ago)
I like the idea of an artist experimenting with alternate presentations of a big batch of songs (the way we in these ILM threads tend to fiddle with the selection / running order of Taylor Swift tracks, for whatever reason).
Not sure these particular re-arrangements really illuminate anything, though...
― “Pizza House!” (morrisp), Wednesday, 2 September 2020 20:44 (five years ago)
(But I'm also not focused on the interconnected narratives that supposedly connect some of these songs.)
― “Pizza House!” (morrisp), Wednesday, 2 September 2020 20:46 (five years ago)
weird that invisible string doesn't appear on any of those "EP" reworkings. probably my fav song on the record at this point!
― petey v, Wednesday, 2 September 2020 20:58 (five years ago)
Huh, I didn't even notice that was missing. Looks like "seven" is also used twice.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Wednesday, 2 September 2020 21:06 (five years ago)
it’s also a way to get “the lakes” on streaming
― maura, Thursday, 3 September 2020 11:56 (five years ago)
it's stupid how good this album is
― alpine static, Monday, 28 September 2020 23:35 (five years ago)
^^^^
― Tim F, Tuesday, 29 September 2020 00:17 (five years ago)
FYI, another EP (this one has “Invisible String”):folklore: the yeah I showed up at your party chapterbetty (Live from the 2020 Academy of Country Music Awards)the 1mirrorball the last great american dynastyinvisible stringcardigan
― I Hate the Aedes (morrisp), Sunday, 4 October 2020 02:50 (five years ago)
the live version of “Betty” substitutes “would you tell me to go straight to hell” for “would you tell me I was chickenshit”
― I Hate the Aedes (morrisp), Sunday, 4 October 2020 02:51 (five years ago)
I don’t see the rhyme or reason in the overlapping song selections in these “chapters.”
― I Hate the Aedes (morrisp), Sunday, 4 October 2020 02:54 (five years ago)
xp sorry - guess the line on the album is “would you tell me to go fuck myself” (don’t know where I got the “chickenshit” thing, lol)
― I Hate the Aedes (morrisp), Sunday, 4 October 2020 03:01 (five years ago)
I say this as a fan of Swift, this album and these chapters - I think it’s as simple as goosing her streaming numbers is all.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Sunday, 4 October 2020 03:18 (five years ago)
I’ve seen at least one other instance of this: Kaash Paige just released an EP that contains four tracks off her recent album (and nothing new).
― I Hate the Aedes (morrisp), Sunday, 4 October 2020 03:41 (five years ago)
It's not much different than her releasing special-edition versions at Target or whatever.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Sunday, 4 October 2020 14:03 (five years ago)
Those have bonus tracks... this is just reshuffling the same batch of songs you could listen to a click away on the album. (It must “work,” though.)
― I Hate the Aedes (morrisp), Sunday, 4 October 2020 16:21 (five years ago)
(the latest Swift “chapter” notwithstanding, which actually does have a non-album track)
― I Hate the Aedes (morrisp), Sunday, 4 October 2020 16:22 (five years ago)
Yeah, I just mean her marketing savvy in general. I feel like she and/or her people have always been really smart about market mechanics, and they've adjusted to them with each release to maximize their returns.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Sunday, 4 October 2020 17:00 (five years ago)
(By smart I partly mean shameless, of course.)
Been getting a lot of questions about the recent sale of my old masters. I hope this clears things up. pic.twitter.com/sscKXp2ibD— Taylor Swift (@taylorswift13) November 16, 2020
Christ, I'm beginning to think this Scooter guy is kind of an asshole. /sarcasm
― soaring skrrrtpeggios (jon /via/ chi 2.0), Monday, 16 November 2020 23:36 (five years ago)
"Plenty of surprises in store," get it?
This is too bad, but basically the epitome of the Steve Albini Baffler essay writ large. When there's millions and millions to be had, someone's gonna be the sucker, and it's often the artist.
― Josh in Chicago, Monday, 16 November 2020 23:44 (five years ago)
I mean, Taylor likely made millions and millions when she left Big Machine and signed with UMG
― flamboyant goon tie included, Tuesday, 17 November 2020 00:47 (five years ago)
I mean obviously she can do whatever she wants, but spending time and creative energy re-recording her old music basically out of pettiness over a business deal that didn't go her way is lame as hell.
― triggercut, Tuesday, 17 November 2020 00:59 (five years ago)
have to say, I agree
― it's AG in your faaaace.... (morrisp), Tuesday, 17 November 2020 01:02 (five years ago)
― triggercut, Monday, November 16, 2020 7:59 PM (three minutes ago)
what an insane post!
― J0rdan S., Tuesday, 17 November 2020 01:03 (five years ago)
even implicitly taking the side of scooter braun and the private equity firm shamrock holdings in any sort of dispute whatsoever...... could not be me
― J0rdan S., Tuesday, 17 November 2020 01:09 (five years ago)
Honestly, I don't care enough to take sides in a dispute between millionaires. I guess I'm just disappointed in how she continuously chooses to react to things that are legitimate grievances not just for her, but for other artists. Her answer is never to advocate for wider structural reform of the music industry or capitalist society, it's always just to make sure that she, specifically, gets what she wants, and that she looks like the Good Guy always. From my perspective, she's the greatest master of public relations in the history of pop music, and has generated a ridiculous amount of social power from that. It's just a shame she doesn't put that to a use besides making herself look good.
― triggercut, Tuesday, 17 November 2020 01:27 (five years ago)
Honestly, I don't care enough to take sides in a dispute between millionaires.
don't lie to us or yourself, c'mon now
― J0rdan S., Tuesday, 17 November 2020 01:31 (five years ago)
the rest of your post is holding her to an impossible standard... i don't see the argument for why it's bad for her to fight to regain ownership of her music. who is the victim here, aside from you, for having to read about taylor swift attempting to position herself as the good guy? the last time we all argued about this the line was that her stans were putting big machine employees in danger bcuz they got one day off of work -- doesn't seem like any of them were assassinated so the other side of this argument will have to come up w/ a new reason as to why taylor swift is a villain for engaging in a publicity battle w/ scooter braun and some private equity firms
― J0rdan S., Tuesday, 17 November 2020 01:40 (five years ago)
the last time we all argued about this the line was that her stans were putting big machine employees in danger bcuz they got one day off of work
lol - you're cold-blooded, dude
― it's AG in your faaaace.... (morrisp), Tuesday, 17 November 2020 01:43 (five years ago)
Someone should make a Taylor Swift version of that Simpsons meme of weird nerds jumping to taking a bullet for Elon Musk.
I'm not sure that thinking she should advocate for change in the music industry rather than whipping up a frenzy of emotion around her specific case of being fucked over by the music industry is holding her to an impossible standard.
Taylor Swift should own the masters of her music. It's not wrong for her to fight for that. And it's nice for Taylor Swift that she has the time, money, platform and resources to wage such a public campaign about her specific case, but with the way she is approaching it, it really does nothing to change anything for anyone else in the future. Should she be obliged to advocate for change in the music industry? Of course not. It just feels like a wasted opportunity, especially from someone with an enormous profile who purports to Care and in her own words "wants to be on the right side of history".
― triggercut, Tuesday, 17 November 2020 01:58 (five years ago)
Her answer is never to advocate for wider structural reform of the music industry or capitalist society, it's always just to make sure that she, specifically, gets what she wants, and that she looks like the Good Guy always.
"Speaking to Variety in January, Swift elaborated: “Well, I do sleep well at night knowing that I’m right, and knowing that in 10 years it will have been a good thing that I spoke about artists’ rights to their art, and that we bring up conversations like: Should record deals maybe be for a shorter term, or how are we really helping artists if we’re not giving them the first right of refusal to purchase their work if they want to?”"
https://variety.com/2020/music/news/scooter-braun-sells-taylor-swift-big-machine-masters-1234832080/
― Tim F, Tuesday, 17 November 2020 01:59 (five years ago)
I think it's worse than "a business deal that didn't go her way"
But I also think it's worse than "her stans were putting Big Machine employees in danger bcuz they got one day off of work"
And lastly, the reason why TS doesn't own her masters is because she was offered them, but elected to walk away from negotiations to sign a (probably extremely lucrative) deal with UMG. Albini-rhetoric does not apply here
― flamboyant goon tie included, Tuesday, 17 November 2020 02:02 (five years ago)
"Speaking to Variety in January, Swift elaborated: “Well, I do sleep well at night knowing that I’m right, and knowing that in 10 years it will have been a good thing that I spoke about artists’ rights to their art, and that we bring up conversations like: Should record deals maybe be for a shorter term, or how are we really helping artists if we’re not giving them the first right of refusal to purchase their work if they want to?”"https://variety.com/2020/music/news/scooter-braun-sells-taylor-swift-big-machine-masters-1234832080/
I don't think those questions are the ones that are being centred given how she and her team have communicated with fans and the media in this saga. Her latest post certainly doesn't make those the issues. The question at the centre of all this is: Should TAYLOR SWIFT own her own music instead of some soulless private equity firm? And of course any sane person will answer yes to that.
But I will be pleasantly surprised and happily proven wrong if any of this actually means that anything is going to change for anyone else.
― triggercut, Tuesday, 17 November 2020 02:17 (five years ago)
you should try, like, reading news articles before you post
https://www.rollingstone.com/pro/news/taylor-swift-universal-republic-deal-spotify-758102/
A source close to the matter tells Rolling Stone that Swift’s alignment with UMG chairman/CEO Sir Lucian Grainge’s approach to artist payments — specifically, his interest in offering Spotify equity to artists without withholding any money owed — was instrumental in the singer’s decision to sign a deal with Universal over the other labels. While sources declined to give financial details, citing the still-hypothetical nature of the matter, Swift said in her announcement that the Spotify provision involves “much better terms” than what Sony and Warner offered.“As part of my new contract with Universal Music Group, I asked that any sale of their Spotify shares result in a distribution of money to their artist, non-recoupable,” Swift wrote in an Instagram post. “They have generously agreed to this, at what they believe will be much better terms than paid out previously by other major labels.” Swift added that the Spotify provision “meant more to me than any other deal point” of the new contract, which also gives her ownership of her masters going forward, and that it’s a sign “we are headed toward positive change for creators — a goal I’m never going to stop trying to help achieve, in whatever ways I can.”
“As part of my new contract with Universal Music Group, I asked that any sale of their Spotify shares result in a distribution of money to their artist, non-recoupable,” Swift wrote in an Instagram post. “They have generously agreed to this, at what they believe will be much better terms than paid out previously by other major labels.” Swift added that the Spotify provision “meant more to me than any other deal point” of the new contract, which also gives her ownership of her masters going forward, and that it’s a sign “we are headed toward positive change for creators — a goal I’m never going to stop trying to help achieve, in whatever ways I can.”
― J0rdan S., Tuesday, 17 November 2020 02:18 (five years ago)
"While sources declined to give financial details"
“They have generously agreed to this, at what they believe will be much better terms than paid out previously by other major labels.”
PR puff pieces aren't news. Absolutely useless information without any specifics as to how that is going to, or has actually helped any artist in a meaningful way.
― triggercut, Tuesday, 17 November 2020 02:28 (five years ago)
Every time I try and unpack my thoughts on this it always ends up with "well, this would all be solved if we just shot Scooter Braun into the sun". Anyway:
First off I think it's unreasonable for anyone to expect TS to actually be "on the right side of history"-- she's a businesswoman and her politics are a method of accumulating profit
Second I don't think it can really be understated how shitty that whole Kim/Kanye "we recorded your phone call" situation must've been for TS-- a narrative that got turned into a "white woman's tears" narrative but ffs watch "Famous" again and tell me she doesn't have a right to be pissed/upset, and pissed/upset at Scooter's participation in it
Third it is not "greed" that motivated Scooter Braun to purchase Big Machine, it was abusive control, full-stop-- Taylor's accusations of this being tied to toxic masculinity are otm as far as I'm concerned
Fourth it is ugly to me that Taylor would take to Twitter to sic her rabid fans on Scooter (and, specifically, the head of Big Machine, who seemingly did nothing wrong but prognosticate that TS would be upset about a sale to Scooter; maybe he should've prognosticated? but his decision was surely not malicious) resulting in death threats on them both, and their families and employees
Fifth I believe Scooter et al. when they claim that Taylor is twisting the narrative when she says they're "blocking" her capacity to perform her own songs
Sixth it seems totally reasonably that Scooter would, in light of these tweets, request an non-disparagement agreement of TS-- and totally unreasonable that TS would then publicly characterize this request as something that "assaulters use to silence their accusers"
Seventh I think this "I'm going to re-record the back catalogue" is an obviously empty threat-- Ithaca bought the publishing to these songs, as well as the masters, so Scooter et al. are gonna be controlling and profiting off their usage regardless of what recording is being used. This threat just strikes me as another form of leverage, idk
In short
I don't think TS should be tweeting bullshit about Scooter Braun so that his family or the Big Machine employees get harassed, instead we should collectively be figuring out a way of shooting him into the sun
― flamboyant goon tie included, Tuesday, 17 November 2020 02:30 (five years ago)
― triggercut, Monday, November 16, 2020 9:28 PM (seven minutes ago)
any cursory following of her well publicized battles w/ apple & spotify would tell you that she's been more vocal about the relationship between artists and streaming services than any other artist of her stature that i can think of. she fought apple when it started apple music w/ a free trial that affected royalty payments to artists, and kept her music off of spotify for three years over essentially their entire business model. she hasn't triggered a paradigm shift or fallen on her sword on behalf of every other musician, but my takeaway from that is the extent to which even the most powerful musicians in the world are at the mercy of consolidated corporations/platforms when it comes to the distribution of music and the profits from it.
again, she's a complicated figure -- her music is always spon-conned out the ass, she decided to go back on spotify eventually and plays very nice w/ them now. she is no anti-capitalist hero. but to argue that she's never used her power to advocate for the rights of musicians w/ less power is flatly wrong. like, literally, i would advise doing some googling and reading very basic articles like on page 1 of the results page and then circling back to this thread bcuz it's clear that you don't know what you're talking about when it comes to this subject.
― J0rdan S., Tuesday, 17 November 2020 02:37 (five years ago)
the idea that scooter braun should be spared the wrath of stans is really funny to me. the entirety of his wealth is based upon cultivating an insanely rabid stan base around justin bieber and then milking that to the point of justin bieber having mental breakdowns on stage. if there's anyone on earth who can't complain about the other side of the coin, it's him.
― J0rdan S., Tuesday, 17 November 2020 02:43 (five years ago)
Maybe she should tell her fanbase to stop using Spotify, tbh
― flamboyant goon tie included, Tuesday, 17 November 2020 02:45 (five years ago)
Sorry, that followed a thought that I didn't actually type:
she's been more vocal about the relationship between artists and streaming services than any other artist of her stature that i can think of.
Yes, this is true, because there are so few (if any) other artists of her stature. Claiming she's been "fighting" Spotify (compared to how the indie community is screaming about it) is kinda disingenuous. I like her music a lot! but she's not my friend
― flamboyant goon tie included, Tuesday, 17 November 2020 02:47 (five years ago)
the idea that scooter braun should be spared the wrath of stans is really funny to me.and the Big Machine staffers who got a fun “day off”? and the Pitchfork writer who received death threats that were reported in the press, but never (please correct me if I’m wrong, I would like to be wrong here) addressed by Taylor (whereas other artists speak out & cool down their stanbase when it comes even to more standard-issue hashtag campaigning and online harassment)?
― it's AG in your faaaace.... (morrisp), Tuesday, 17 November 2020 02:49 (five years ago)
I’m a fan of her music, but her willingness to weaponize stans and overlook or even encourage the perception of real-life danger – especially after experiencing such threats herself – makes me think she is not a cool person. (The Soros boogeyman stuff was pretty weird too, tbh)
― it's AG in your faaaace.... (morrisp), Tuesday, 17 November 2020 02:51 (five years ago)
any cursory following of her well publicized battles w/ apple & spotify would tell you that she's been more vocal about the relationship between artists and streaming services than any other artist of her stature that i can think of. she fought apple when it started apple music w/ a free trial that affected royalty payments to artists, and kept her music off of spotify for three years over essentially their entire business model.
Happy to see any articles from other less powerful artists who have come out and said that the actions of Taylor Swift have made an actual material impact on the amount of control they have over their music, or over the amount of money that they earn.
― triggercut, Tuesday, 17 November 2020 02:52 (five years ago)
when taylor turns one third of the USA into a socialist utopia triggercut is gonna have some real egg on their face.
― Tim F, Tuesday, 17 November 2020 02:55 (five years ago)
Way to move the goalpost there
Anyway did folklore come out in July? Feels like two years ago
― self-clowning oven (Murgatroid), Tuesday, 17 November 2020 02:55 (five years ago)
Must be nice having such a good faith in capitalists to believe that any of this was about anything but the amount of money she herself stood to earn.
― triggercut, Monday, November 16, 2020 9:52 PM (four minutes ago)
look, i'm just having the argument on your terms -- you asked for her to advocate for other artists with less power than her, and i pointed out that there have been several very well publicized instances of her using her platform to do this. again, try doing some reading. your standard of taylor swift "having made an actual material impact on the amount of control" artists have over their music, or the amount of money they earn, shows an extreme naivety about the entire nature of the music industry, or a desire to argue disingenuously on a subject on which you claim to not be taking any sides. i guess we can continue to try and find out which it is.
― J0rdan S., Tuesday, 17 November 2020 03:01 (five years ago)
J0rdan give a link instead of saying "try doing some reading"! I'm interested but no I'm not going to google on your behalf
Also
In 2015, Project Panther (which is controlled and owned by Jay-Z) bought Aspiro (the developers of Tidal) for $56m. (Tidal continues to pay their artists 4x per play what Spotify pays.)
But yeah I can feel your eyes rolling as I'm typing this
― flamboyant goon tie included, Tuesday, 17 November 2020 03:04 (five years ago)
ok, a point for jay z. i forgot about tidal.
here's a news article in the guardian about how she wrote a blog post directed at apple over their decision to not pay royalties during their initial free trial period, siding w/ indie labels such as beggars, and got them to reverse the decision
https://www.theguardian.com/technology/2015/jun/22/apple-music-royalties-free-trial-taylor-swift
― J0rdan S., Tuesday, 17 November 2020 03:11 (five years ago)
and look, apple still pays shit royalties and taylor swift does commercials for them. i'm not painting her as a hero. she's a populist and a capitalist at heart -- i wrote a whole long article on this subject myself.
https://www.spin.com/featured/taylor-swift-pop-music-me-essay/
but to say she doesn't use her platform to advocate for artists w/ less power than her isn't true. and from there i would consider who has the power here -- the three label corporations and two streaming services that currently control how we consume basically the entirety of music, or one taylor swift.
― J0rdan S., Tuesday, 17 November 2020 03:16 (five years ago)
And fair point abt the free trial session re: Apple. I wonder how much that concession cost Apple! probably a lot, tbh
― flamboyant goon tie included, Tuesday, 17 November 2020 03:30 (five years ago)
In this situation, Swift has more and less power than we'd think-- she definitely has "more" power in the ruination of an indie label (Big Machine) or an individual (Scooter Braun) with her capacity to activate her fanbase. She has "less" power with regards to her own career than we'd think-- she, too, has to negotiate contracts and will find her creations bought and sold by individuals she'd prefer not to buy and/or sell her work. Considering that a "constructive" solution to The Streaming Problem (TIDAL) failed, I'd be interested to see what kind of "destructive" solution Taylor might come up with re: Spotify. Seriously! Couldn't she sic her fans on Daniel Ek? That's be great
― flamboyant goon tie included, Tuesday, 17 November 2020 03:34 (five years ago)
she is very devoted to the idea of her music reaching as many impressionable souls as possible -- this was her explicit reasoning for writing "me," which is a terrible song. i wonder if she would truly want to shatter the DSP system when it's how so many of her fans access her music -- she already caved on this subject once by going back to spotify after her three year hiatus. on the one hand there's the obvious fact that being on streaming makes her more money, but in terms of the overall slice of the taylor swift income pie i would imagine it's pretty small. i feel like she basically already tried the protest, and it didn't really matter bcuz no other artists joined her, and she decided she would rather ppl be able to listen to her music there than not. this is where the power dynamics come into play... what can one person even of her stature actually do, and who is she actually hurting? i think in the case of the spotify boycott she eventually reasoned her fans were losing out more so than spotify. and then to what extent are her decisions driven by her desire to be accessible to her fans vs her desire to make money. it's all very debatable but i do feel like she has tried to hash it out in a public fashion in a way that a large number of her peers are not
― J0rdan S., Tuesday, 17 November 2020 05:04 (five years ago)
That's very reminiscent of Pearl Jam v. Ticketmaster. They tried, no one really had their back, and in the end they decided better to do the best they could from the belly of the beast. Which they more or less have.
― Josh in Chicago, Tuesday, 17 November 2020 13:33 (five years ago)
She signed the fucking contract. This whining from a billionaire singer is fucking ridiculous. She got fame and fortune out of her contract and now she wants more. Fuck that.
― brotherlovesdub, Tuesday, 17 November 2020 16:47 (five years ago)
She was 15 when she signed the contract!
― soaring skrrrtpeggios (jon /via/ chi 2.0), Tuesday, 17 November 2020 16:49 (five years ago)
Sure, she signed it alone without lawyers there explaining what it meant? Was she also a millionaire at 15 or did she have to wait to 16 before she banked her first million? She got what she wanted out of the contract. In related news, my mortgage company expects me to keep paying them money all because i signed some fucking papers. It's SO UNFAIR.
― brotherlovesdub, Tuesday, 17 November 2020 16:53 (five years ago)
Good to see this thread revealing all of the predatory corporation bootlickers.
No one should be held to something for the rest of their lives that they signed at 15.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Tuesday, 17 November 2020 16:56 (five years ago)
― brotherlovesdub, Tuesday, November 17, 2020 11:53 AM (twenty-nine minutes ago)
psychotic posts
― J0rdan S., Tuesday, 17 November 2020 17:26 (five years ago)
that is a post from everyone's conservative cousin about student loan forgiveness.
― foopin posts and pissin shits (Sufjan Grafton), Friday, 20 November 2020 04:06 (five years ago)
yeah I totally get giving the kids of a financial-sector goons the side-eye but that seems like a bit much even to me
― it bangs for thee (Simon H.), Friday, 20 November 2020 05:00 (five years ago)
Huzzah
Well it’s 11/24 and 24-11=13 so I’ve got an announcement 🤓 You haven’t seen this film before ✨ folklore: the long pond studio sessions will be out tonight at midnight PST on @DisneyPlus! #folkloreOnDisneyPlus pic.twitter.com/BTWSRM0yaI— Taylor Swift (@taylorswift13) November 24, 2020
― Ned Raggett, Tuesday, 24 November 2020 14:08 (five years ago)
That was.. really great. Album is a beautiful fit for a filmed studio session.
― abcfsk, Wednesday, 25 November 2020 16:39 (five years ago)
ugh i need to see this, currently asking all of my friends for a disney plus login
― mellon collie and the infinite bradness (BradNelson), Wednesday, 25 November 2020 16:40 (five years ago)
yeah this was fucking amazing. "epiphany" suddenly my favorite song
― mellon collie and the infinite bradness (BradNelson), Wednesday, 25 November 2020 23:57 (five years ago)
Quite good indeed. Rather liked “Mirrorball.”
― Ned Raggett, Thursday, 26 November 2020 06:13 (five years ago)
yeah the version of "epiphany" on this is a highlight
― ufo, Thursday, 26 November 2020 06:54 (five years ago)
Haven't had a chance to watch the film yet, but listening to the Long Pond Studio Sessions today and am quite impressed with what they were able to do with so little. It's a lovely, clear, intimate performance that reminds me of "unplugged" live recordings.
― Indexed, Monday, 30 November 2020 17:38 (five years ago)
Looking forward to watching this with my family, but I must admit I raised an eyebrow at her dramatic make-under of not-straight hair and flannel. Reminded me of one of those political ads (or mock political ads) of some typically dark-suited dude in a red flannel shirt out in the snow chopping logs for votes.
― Josh in Chicago, Monday, 30 November 2020 17:45 (five years ago)
"epiphany" is gorgeous
― Indexed, Monday, 30 November 2020 17:48 (five years ago)
I thought this was really good, though I'm only about 2/3rds of the way through so far. As Ned says, "Mirroball" was a highlight too.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Monday, 30 November 2020 17:49 (five years ago)
xxp probably better to not invite over a makeup/hair team over just to make herself more fuckable during a pandemic
― self-clowning oven (Murgatroid), Monday, 30 November 2020 18:04 (five years ago)
sorry that was harsh, I should have left it at "who fucking cares"
More like the more relaxed look is much more suited to this album's vibe and themes.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Monday, 30 November 2020 18:08 (five years ago)
Probably also a corrective to the years she spent trying to meet media/fashion industry standards for "perfect" and very feminine clothes/hair/makeup every time she left the house.
― Lily Dale, Monday, 30 November 2020 18:15 (five years ago)
Good point as well! That was the part from her documentary that really stuck with me.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Monday, 30 November 2020 18:17 (five years ago)
Listening to the Studio Sessions tracks now -- I agree, they're really nice. (She also doesn't sound like she's singing "toilet" on "Mirrorball," which is a plus.)
― meditate in my direction (morrisp), Monday, 30 November 2020 19:28 (five years ago)
What I found so striking about this is how hyper-literate and rational Taylor is in describing her own songs. It’s all very “I started with this fundamental premise which grew out of this aspect of the arrangement, and I embellished it by connecting it with this other idea over here, which is explored more fully in this other song...” It’s like you’re reading a Wikipedia or Genius entry.
― Tim F, Monday, 30 November 2020 19:48 (five years ago)
yeah, it was funny to see the contrast between the internet's fantastical readings of i.e. "betty" as an autobiographical admission of lesbian love and taylor's explanation of "well joe had written this entire chorus, and i thought it was really good, and i also realized i'd never sung a song from a man's POV apologizing to a woman, it's always the woman asking a man for an apology, so i thought it would be interesting to include that in my discography." she alludes to the autobiographical nature of some of the songs (mostly as it pertains to scooter braun or kanye) but so much of her songwriting process seems to be wrapped up in either subverting or bolstering her entire previous history as a songwriter. every song is a puzzle piece in the context of her full discography which sounds exhausting but is sort of clarifying.
that said i wish to forget the whole discussion about how celebrities are like disco balls
― J0rdan S., Monday, 30 November 2020 20:07 (five years ago)
Haha yeah I found that part unhelpful too.
I think it’s astute to connect “Mirrorball” with “This Is Me Trying”, but it goes beyond the idea of “trying”, or perhaps rather that idea is bigger than it seems. Both songs are profiles of the same personality type - the person who is motivated by the need to be things for others, to give them what they want, who perhaps isn’t sure if they have a genuine real persona just for themselves - but from different vantages, with the latter focusing on the limitations of that persona and the former on how its successes can conceal the limitations.
The mirrorball metaphor is or should be about more than celebrity culture: the key point is that mirrorballs only reflect and retract light from another source. “I’ll show you every version of yourself tonight” - because I don’t have a “myself” to show; the glittery surface is also the core.
But the literal details of how all that manifests in Taylor’s life - as a celebrity who goes on tour - are the least interesting part of that frame - and only serve to make the frame seem less empathetic than it is.
― Tim F, Monday, 30 November 2020 21:13 (five years ago)
I love the vulnerability in the Mirrorball lyric, the part about "I've never been a natural/all I do is try, try, try." Maybe a little more revealing than Taylor is comfortable talking about?
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Monday, 30 November 2020 21:18 (five years ago)
yeah the more literal that explanation gets the more limiting the song feelsi did like her explanation of “peace” tho which is a branch off the same tree. but for me there’s also something more deeply felt about that production and vocal performance compared to “mirrorball” that makes it more easily transcend her specific context for it
― J0rdan S., Monday, 30 November 2020 21:24 (five years ago)
I had some thoughts:
https://www.patreon.com/posts/covid-coping-44462404
― Ned Raggett, Monday, 30 November 2020 21:32 (five years ago)
Ned, the Laid analogy is unexpected and apt.
― Patriotic Goiter (Alfred, Lord Sotosyn), Monday, 30 November 2020 21:54 (five years ago)
lol now I'm imagining a Swift album produced by Eno.
― Josh in Chicago, Monday, 30 November 2020 22:16 (five years ago)
quite easy!
― Patriotic Goiter (Alfred, Lord Sotosyn), Monday, 30 November 2020 22:17 (five years ago)
I'd be down, of course. It might be like this:
https://www.youtube.com/watch?v=R9FW1N2FR_w
― Josh in Chicago, Monday, 30 November 2020 22:18 (five years ago)
I’m imagining one produced by Albini.
― meditate in my direction (morrisp), Monday, 30 November 2020 22:23 (five years ago)
I bet a Swift alone with piano or guitar album produced by Albini would sound great.
― Josh in Chicago, Monday, 30 November 2020 22:25 (five years ago)
Better than a Shellac album produced by Eno.
I'm imagining Taylor Swift producing The National.
― Patriotic Goiter (Alfred, Lord Sotosyn), Monday, 30 November 2020 22:25 (five years ago)
Swift by Eno could come too close to Surprise.
― ... (Eazy), Monday, 30 November 2020 22:29 (five years ago)
^^^^ I had the same thought.
― Patriotic Goiter (Alfred, Lord Sotosyn), Monday, 30 November 2020 22:32 (five years ago)
had to partially tune out the "mirrorball" convo once i realized swift's interpretation of the song was much... narrower than mine, but i think she did a least a little bit of work to expand that interpretation beyond the limits of her own celebrity by saying it's about "people who have to be on all the time." kinda think that feeds into my idea of the song, which is that it's about a chronic people-pleaser who has no inner resources to fall back on once said people leave. also i think i'm just repeating tim's post, which is otm
― mellon collie and the infinite bradness (BradNelson), Monday, 30 November 2020 22:36 (five years ago)
Thanks -- a random flash thought the other day that suddenly made a huge kind of sense.
― Ned Raggett, Monday, 30 November 2020 23:01 (five years ago)
"Swift by Eno could come too close to Surprise."
or one of his boring ass Coldplay albums. he'd be the wrong producer for her (as much as I like his work on that Siberry album)
― akm, Monday, 30 November 2020 23:11 (five years ago)
had to partially tune out the "mirrorball" convo once i realized swift's interpretation of the song was much... narrower than mine, but i think she did a least a little bit of work to expand that interpretation beyond the limits of her own celebrity by saying it's about "people who have to be on all the time." kinda think that feeds into my idea of the song, which is that it's about a chronic people-pleaser who has no inner resources to fall back on once said people leave.
is it too circular to say that this is otm?
jordan's following observations are almost like a meta-version of this:
she alludes to the autobiographical nature of some of the songs (mostly as it pertains to scooter braun or kanye) but so much of her songwriting process seems to be wrapped up in either subverting or bolstering her entire previous history as a songwriter. every song is a puzzle piece in the context of her full discography which sounds exhausting but is sort of clarifying.
The fact that taylor even thinks of her discography in these terms is just another example of her chronic people-pleasing, which is not just about pleasing people but also constantly situating yourself from the perspective of the other, asking "how will this be perceived by (insert)?" Which can be simultaneously selfish and selfless.
And then of course "mirrorball" (or lol even "me!") could be read as meta-commentary on her discography and songwriting approach.
― Tim F, Monday, 30 November 2020 23:15 (five years ago)
― All cars are bad (Euler), Monday, 30 November 2020 23:37 (five years ago)
I think the current re-recording process could actually work out really well if done properly - rather than her just redo the albums I'm imagining a 2-cd album that is effectively a greatest hits collection and draws out different nuances to the older songs. I remember the glassy synthesiser version of "Love Story" (very "You Are In Love") from the 1989 tour was really lovely.
For me the best production job on Folklore (and a lot of the time my favourite song give or take "Peace") is "August", due to the real unity of vocal, emotional and arrangement heft - the sudden hit of the guitars during the second repeat of the second bridge ("second repeat of the second bridge" is such a taylor trick) is both obvious and inspired, and shows an increasing sense on her part and the part of her producers of how to deploy arrangement and production tricks that are very specific to the songs in question and designed to draw out their specific qualities. But yes, I think a fairly obvious "future pathway" for TS is to further explore a kind of gauzy textural vibe, whether it's organic or synthetic or somewhere in between.
Upthread I said I'd enjoy hearing Taylor produced by Jenn Wasner, and I was thinking specifically of Wye Oak's live performance of "We Belong", the sound of which would be a logical next step after Folklore IMO.
― Tim F, Monday, 30 November 2020 23:58 (five years ago)
I'm warming to the idea of the re-records, as an artistic proposition.
― meditate in my direction (morrisp), Tuesday, 1 December 2020 00:36 (five years ago)
Yeah, is there a precedent for it from someone at her career point? I feel like the ones I can think of were all done when people were older, past commercial prime, etc.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Tuesday, 1 December 2020 02:12 (five years ago)
One example that comes to mind is Ani DiFranco with 'Like I Said', which was a re-recording of songs from her first few albums which were effectively demos, though if anything she did it too early, a bare handful or years after the relevant albums and before she had sufficient distance (sonically/production-wise or otherwise) from the original material to make the exercise really interesting (also, I'm not sure if the issues with the first few DiFranco albums are their sparse production, really).
― Tim F, Tuesday, 1 December 2020 02:46 (five years ago)
Lucinda Williams re-recorded Sweet Old World a few years back
― bunny slopes, Tuesday, 1 December 2020 03:04 (five years ago)
Car Seat Headrest re-recorded an old album recently; but there's not much analogous there otherwise.
― meditate in my direction (morrisp), Tuesday, 1 December 2020 03:20 (five years ago)
https://images-na.ssl-images-amazon.com/images/I/41TGzowBKeL._SX466_.jpg
― "what are you DOING to fleetwood mac??" (C. Grisso/McCain), Tuesday, 1 December 2020 03:22 (five years ago)
Didn't know that about Lucinda, I'll have to look for it. I love that album.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Tuesday, 1 December 2020 03:50 (five years ago)
Camper Van Beethoven re-recorded some of their Virgin stuff for a couple of comps. ELO re-recorded its greatest hits relatively recently, to get more licensing money.
― Josh in Chicago, Tuesday, 1 December 2020 04:09 (five years ago)
Squeeze did as well.
― "what are you DOING to fleetwood mac??" (C. Grisso/McCain), Tuesday, 1 December 2020 04:46 (five years ago)
Suzanne Vega:
Vega says she always thought re-recording the songs "was something that certain fans would like, 'cause there's always been a lot of discussion about the production of the different albums. It's something that I did particularly for fans that really like the songs and would really like to hear it just in a more simple form, stripping it away from the production."But another reason for the project was that the major labels for which the songs were recorded now control those recordings."If they decide that they never want to release my albums again, they can do that," she says. "So a lot of my albums are going out of print. … So this gives me a physical product to sell at my shows, it means I have the rights to these recordings, I can license them out to television shows or do whatever. I can promote my own recordings."
But another reason for the project was that the major labels for which the songs were recorded now control those recordings.
"If they decide that they never want to release my albums again, they can do that," she says. "So a lot of my albums are going out of print. … So this gives me a physical product to sell at my shows, it means I have the rights to these recordings, I can license them out to television shows or do whatever. I can promote my own recordings."
― ... (Eazy), Tuesday, 1 December 2020 13:26 (five years ago)
Apparently Def Leppard has been doing this!
https://www.youtube.com/watch?v=ATHp6humam8
https://www.youtube.com/watch?v=-cXNaCcw_PI
I do love the idea of Def Leppard re-recording one of the most expensive sessions of all time on, I dunno, probably Garageband or something.
― Josh in Chicago, Tuesday, 1 December 2020 13:41 (five years ago)
Oh man, that "Pour Some Sugar" is ... not painful exactly, but not good. Mutt Lange earned his money for a reason.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Tuesday, 1 December 2020 20:36 (five years ago)
And just to nudge the thread back on track:
https://www.youtube.com/watch?v=QBBCJUNtQ6k
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Tuesday, 1 December 2020 20:37 (five years ago)
Okay so while my new re-records are NOT done, my friend @VancityReynolds asked me if he could use a snippet of one for a LOLsome commercial he wrote so...here’s a sneak peak of Love Story! Working hard to get the music to you soon!! https://t.co/0vBFXxaRXR— Taylor Swift (@taylorswift13) December 2, 2020
― groovypanda, Wednesday, 2 December 2020 14:49 (five years ago)
lmao. Sounds good though it seems the earnest-to-a-fault vibe of her teenage albums is inimitable by a 30-year-old in 2020.
― Indexed, Wednesday, 2 December 2020 14:51 (five years ago)
had trouble discerning that it was a rerecording, so my expectations for these are once again nonexistent
she is a much better singer now tho
― mellon collie and the infinite bradness (BradNelson), Wednesday, 2 December 2020 14:53 (five years ago)
Or rather I should say, she doesn't seem to be trying to go for that same vibe
― Indexed, Wednesday, 2 December 2020 14:53 (five years ago)
The joy of having all these re-recordings drop will be to relive the album releases more so than finding minor improvements in her phrasing or whatever. I will be curious if she decides to dramatically remix any of the tracks. Weren't there multiple versions of "Love Story" created for different radio formats?
― Indexed, Wednesday, 2 December 2020 14:58 (five years ago)
Maybe this has already been revealed, but is she gonna press up new physical copies of all this stuff and, like, tell her fans to throw away all the old copies and buy the new ones to stick it to Scooter? That would kind of be amazing.
― alpine static, Wednesday, 2 December 2020 17:47 (five years ago)
Ugh, yeah, if she's not going to play around with new arrangements or anything on these, I'm not going to be nearly as interested as I might have been.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Wednesday, 2 December 2020 17:55 (five years ago)
If her purpose is to make her old recordings valueless, it would make sense that she's going for as close to the original as possible. If she plays around with new arrangements, her fans will buy the new recordings, but they won't stop streaming the old ones.
― Lily Dale, Wednesday, 2 December 2020 22:17 (five years ago)
I honestly don't see any way she stops fans from streaming the old versions. Those were formative albums for a lot of people and I don't think people everyone would just stop listening to them completely even if her rerecordings are going to be as faithful as possible.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Wednesday, 2 December 2020 22:28 (five years ago)
lot of old rappers have done this
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Wednesday, 2 December 2020 22:29 (five years ago)
Yeah, I don't really see it working, but I think that's what she's going for. The goal isn't just to have recordings of her own work that she owns, it's also to screw over Scooter and anyone connected to him.
― Lily Dale, Wednesday, 2 December 2020 22:36 (five years ago)
so much of it depends on how spotify and apple bend to her will -- there's all sorts of factors like what shows up in search, in algorithms, on playlists, how her discography is displayed on her profile pages, what is highlighted, what isn't, how things are packaged for the user etc that will be conscious decisions made by people at platforms trying to balance the priorities and desires of two diff but very powerful sides. the passive streamers of her music who just click on the first thing that appears in a search result or on her profile page will be a far larger slice of the population than the stans who go out of their way to only stream certain music bcuz they too are invested in screwing over scooter braun
― J0rdan S., Wednesday, 2 December 2020 23:34 (five years ago)
Doesn't Spotify reflect recent plays in addition to total plays? That could help her there, because the re-recordings will get a ton of listens when she first releases them.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Thursday, 3 December 2020 00:50 (five years ago)
Anecdotal data points: My wife and both daughters started the Folklore movie last night but couldn't finish it. My 13-year-old, who has seen Miss Americana more than once, was not interested in the performances and wished there was more documentary. My wife iirc thought it felt too much like watching successful people just hanging out in a beautiful location. she and my older daughter swapped it out for a Harry Styles documentary, which both enjoyed a lot more.
Dunno why it rubbed them all the wrong way, I watched the first 20 minutes or so and it seemed fine to me.
― Josh in Chicago, Saturday, 5 December 2020 20:24 (five years ago)
Thought about turning it off bc of way Jack leans forward to play acoustic guitar
― Stephen Tobo Lowskywhine (Sufjan Grafton), Saturday, 5 December 2020 20:31 (five years ago)
I like her songs, but have little to no interest in seeing/watching her perform.
― wet tip hen ax (egg drop mix) (morrisp), Saturday, 5 December 2020 20:37 (five years ago)
I don’t have Disney + but I watched the bits that are on YouTube, the sitting round the campfire excerpts were cringey but some of the performances were cool, especially the bon iver track (and I’ve resigned myself to realizing I seem to be one of the few people who really loves that song)
― Evans on Hammond (evol j), Saturday, 5 December 2020 21:21 (five years ago)
It’s my favorite on the album!
― wet tip hen ax (egg drop mix) (morrisp), Saturday, 5 December 2020 21:23 (five years ago)
I loved the show and was glad it was mostly a concert, not a documentary. I've always appreciated her stripped down live performances. Past couple of albums the stripped doww live versions of her songs have improved on the over-produced album versions, but folklore was always meant to sound like this so I was eager, since its release, to hear how it would translate live, and I liked it and it's clear this is how she sounds the best live, but it doesn't quite gel with her stadium tours.
― abcfsk, Saturday, 5 December 2020 22:05 (five years ago)
Thought the exile performance somehow was captivating and perfect as a 2020 duet.
― Stephen Tobo Lowskywhine (Sufjan Grafton), Sunday, 6 December 2020 00:42 (five years ago)
i freakin' love Exile and i have never liked a note of Vernon's music, and yes, the Long Pond duet is excellent
<i>not interested in the performances and wished there was more documentary. My wife iirc thought it felt too much like watching successful people just hanging out in a beautiful location</i>
i would really be much more interested in a documentary than either of these other two options. i might just stick to streaming the performances on Apple Music.
― alpine static, Sunday, 6 December 2020 03:33 (five years ago)
sorry about the formatting
― alpine static, Sunday, 6 December 2020 03:34 (five years ago)
Maybe I’ll watch the “Exile” performance after catching up on The Midichlorian tonight.
― wet tip hen ax (egg drop mix) (morrisp), Sunday, 6 December 2020 03:50 (five years ago)
Ok yeah, the performances are nice - but these scenes of her and Antonoff perched on uncomfortable-looking chairs in coats are really awkward
― wet tip hen ax (egg drop mix) (morrisp), Sunday, 6 December 2020 05:20 (five years ago)
Never really listened to Taylor Swift before but I liked this special a lot, and I like this album. Really like The National dude’s piano sound.
― brimstead, Sunday, 6 December 2020 05:35 (five years ago)
I didn’t think it was that awkward but idk
I guess unfair for me to judge, since I really don’t care to hear them talk about the songs.
― wet tip hen ax (egg drop mix) (morrisp), Sunday, 6 December 2020 06:14 (five years ago)
Obviously will never stop streaming the old ones. Def Leppard tried this, but finally kind of surrendered to letting people stream the old ones instead, even if the new recordings were very close to the originals (but no cigar).
― The GeirBot (Geir Hongro), Sunday, 6 December 2020 22:56 (five years ago)
Oh, and I love "Folklore". I have found earlier Swift releases quite nice in a way, but this is brilliant.
― The GeirBot (Geir Hongro), Sunday, 6 December 2020 22:57 (five years ago)
*blinks*
― mellon collie and the infinite bradness (BradNelson), Sunday, 6 December 2020 22:57 (five years ago)
https://i.guim.co.uk/img/media/74e5a132a35ede8e1c2b8d3af3313518e2b84e70/0_0_1800_1080/master/1800.jpg?width=620&quality=85&auto=format&fit=max&s=f963c8e27a3deb0419f299702db89ffc
― Tim F, Sunday, 6 December 2020 22:59 (five years ago)
The worlds realign
― Ned Raggett, Sunday, 6 December 2020 23:25 (five years ago)
lmao new album tonight - Evermore
― self-clowning oven (Murgatroid), Thursday, 10 December 2020 13:16 (five years ago)
wow
― All cars are bad (Euler), Thursday, 10 December 2020 13:26 (five years ago)
omfg
― mellon collie and the infinite bradness (BradNelson), Thursday, 10 December 2020 13:36 (five years ago)
oh damn!!!!
i'm glad december surprise albums are back
tracklist:willowchampagne problemsgold rush'tis the damn seasontolerate itno body, no crime (feat. Haim)happinessdorotheaconey island (feat. The National)ivycowboy like melong story shortmarjorieclosure (feat. Bon Iver)
bonus tracks:right where you left meit's time to go
― ufo, Thursday, 10 December 2020 13:40 (five years ago)
tis the damn season!!!!!!!
― mellon collie and the infinite bradness (BradNelson), Thursday, 10 December 2020 13:40 (five years ago)
I wanna think Taylor is a combination of Lohan yelling ‘I’m bored I’m so bored’ and Lisa Simpson with her perpetual motion machine
― Its big ball chunky time (Jimmy The Mod Awaits The Return Of His Beloved), Thursday, 10 December 2020 13:43 (five years ago)
excited for the piano magic cover
― it bangs for thee (Simon H.), Thursday, 10 December 2020 13:44 (five years ago)
taylor in this house we obey the laws of thermodynamics!
― mellon collie and the infinite bradness (BradNelson), Thursday, 10 December 2020 13:46 (five years ago)
side note but has anyone ever done an album where the first song is called "tracklist:"? that would be a good bit
― it bangs for thee (Simon H.), Thursday, 10 December 2020 13:48 (five years ago)
surely that's the next phoebe bridgers album
― mellon collie and the infinite bradness (BradNelson), Thursday, 10 December 2020 13:49 (five years ago)
The problem with champagne = too sweet, gives you mad hangovers
― Patriotic Goiter (Alfred, Lord Sotosyn), Thursday, 10 December 2020 13:49 (five years ago)
That’s why you drink a dry champagne
― Ned Raggett, Thursday, 10 December 2020 13:54 (five years ago)
or prosecco
or nothing
― Patriotic Goiter (Alfred, Lord Sotosyn), Thursday, 10 December 2020 14:03 (five years ago)
Poor tactical choice from Taylor adding a vote splitter to the ILX awards.
― abcfsk, Thursday, 10 December 2020 14:14 (five years ago)
ILX Pre-Cover before sundown!
Also, what better way to leave your old masters behind (in both senses of the word).
― ... (Eazy), Thursday, 10 December 2020 14:16 (five years ago)
holy shit!
more dessner / antonoff stuff, do we think?
― alpine static, Thursday, 10 December 2020 14:18 (five years ago)
For Alfred:
And the track list... Champagne problems?!!!! Yes!!! I have those.— Adam Rippon (@AdamRippon) December 10, 2020
― Ned Raggett, Thursday, 10 December 2020 14:20 (five years ago)
She's calling it a sister record to Folklore and looks like it's the same collaborators xp
― groovypanda, Thursday, 10 December 2020 14:22 (five years ago)
xp yes
"And I loved creating these songs with Aaron Dessner, Jack Antonoff, WB, and Justin Vernon. We’ve also welcomed some new (and longtime) friends to our musical kitchen table this time around..."
last part probably refers to the new featurings, Haim and the National proper
― abcfsk, Thursday, 10 December 2020 14:22 (five years ago)
IF she wrote "Campari Conundrum," I'd sympathize.
― Patriotic Goiter (Alfred, Lord Sotosyn), Thursday, 10 December 2020 14:23 (five years ago)
Negroni Negging
― Ned Raggett, Thursday, 10 December 2020 14:25 (five years ago)
Now she can be nominated for Album of the Year again next year.
― MarkoP, Thursday, 10 December 2020 14:27 (five years ago)
'tis the damn season
keeping it edgy I see
― it bangs for thee (Simon H.), Thursday, 10 December 2020 14:28 (five years ago)
actually v considerate of her to votesplit herself before our EOYs tbh
― imago, Thursday, 10 December 2020 14:58 (five years ago)
"excited for the piano magic cover" haha had to scrutinize the tracklist to get this joke.
― akm, Thursday, 10 December 2020 15:14 (five years ago)
That’s wild news... Respect.
― good karma, my aesthetic (morrisp), Thursday, 10 December 2020 15:21 (five years ago)
it's time to go
OTM
― DJP, Thursday, 10 December 2020 15:24 (five years ago)
lmao @ 'Respect'
― imago, Thursday, 10 December 2020 15:24 (five years ago)
hoping "dorothea" is Taylor's musical book report on Middlemarch
― Evans on Hammond (evol j), Thursday, 10 December 2020 15:32 (five years ago)
if you see "Daniel Deronda," you know she's been busy.
― Patriotic Goiter (Alfred, Lord Sotosyn), Thursday, 10 December 2020 15:39 (five years ago)
pissed this isn't titled folkmore
― rob, Thursday, 10 December 2020 15:46 (five years ago)
she finally admitted in an interview that she'd been inspired by jane eyre, which we all suspected listening to 'invisible string', so now all bets are off, george eliot could be in there, maybe a touch of fanny burney
― abcfsk, Thursday, 10 December 2020 17:33 (five years ago)
it is obvious that she is a he!
― xzanfar, Thursday, 10 December 2020 17:36 (five years ago)
She said "Hey babe...."
― Mark G, Friday, 11 December 2020 00:21 (five years ago)
well damn!
― brimstead, Friday, 11 December 2020 00:57 (five years ago)
It’s a very WASP-y Hanukkah!
― good karma, my aesthetic (morrisp), Friday, 11 December 2020 01:06 (five years ago)
This Long Pond Studio Sessions works nice with an edible.
― ... (Eazy), Friday, 11 December 2020 04:21 (five years ago)
This commercial came on tv and cracked me up:https://www.youtube.com/watch?v=lf61VOwW-Ck
― one of the only artist who is genuine (morrisp), Saturday, 23 January 2021 22:26 (five years ago)
This is pretty good:
https://www.youtube.com/watch?v=gnz5LPIMYYo
― jaymc, Monday, 25 January 2021 21:30 (five years ago)
I dig the new ("original") version of "The Lakes" that she released - the track is nice this way, with the strings running throughout. (The lyrics are v good, too; I hadn't registered them but looked them up.)
― Low FODMAP* Snack Ideas (morrisp), Thursday, 29 July 2021 18:56 (five years ago)
one of the best albums of all time
― flopson, Friday, 12 May 2023 08:00 (three years ago)
I think it hits the skids at "Mirrorball"; regains its footing with "Invisible String, "before immediately losing it again; and then has a few pretty good tracks before its shoulda-been closer, "Peace" (why she then stuck "Hoax" at the end, I'll never understand!)
― Day 1 fan (morrisp), Tuesday, 6 June 2023 00:17 (three years ago)
(As a rough draft for "Evermore," it's an OK effort...)
― Day 1 fan (morrisp), Tuesday, 6 June 2023 00:19 (three years ago)
Lol, "Seven" and "August" are probably my two favourite songs here.
Probably the only tracks I'd describe as clearly second tier are "Mad Woman" and "Hoax" (and "The Lakes" if it counts).
― Tim F, Tuesday, 6 June 2023 05:46 (three years ago)
Yeah, I agree those are objectively the weakest tracks. My dislike for (say) “August” and “Mirrorball” is probably more personal to myself; I just really don’t care for those melodies.
― Day 1 fan (morrisp), Tuesday, 6 June 2023 05:52 (three years ago)
(“Seven” is probably decent in a vacuum, but somehow “Mirrorball” sours my ears to it…)
― Day 1 fan (morrisp), Tuesday, 6 June 2023 05:54 (three years ago)
"mirrorball" and "august" are some of the best tracks on this
― ufo, Tuesday, 6 June 2023 07:13 (three years ago)
obsessed with "mirrorball"
― horseshoe, Tuesday, 6 June 2023 14:28 (three years ago)
been listening to this album nonstop recently; i think when it came out i lacked the focus to listen to anything? it is super-good! she sounds like she's trying to sing like joni mitchell on "peace." some of her best lyrics ever on this album.
― horseshoe, Tuesday, 6 June 2023 14:30 (three years ago)
only second tier song to me is "cardigan"
Haha, see, I like that one
― Day 1 fan (morrisp), Tuesday, 6 June 2023 14:31 (three years ago)
furthermore:
IM STILL A BELIEVER BUT I DONT KNOW WHYILL NEVER BE A NATURALALL I EVER DO IS TRY TRY TRY
― horseshoe, Tuesday, 6 June 2023 14:31 (three years ago)
...
― horseshoe, Tuesday, 6 June 2023 14:32 (three years ago)
IM STILL ON THAT TIGHTROPEIM STILL TRYING EEEEEVERYTHINGTO KEEP YOU LOOKING AT ME
― horseshoe, Tuesday, 6 June 2023 14:33 (three years ago)
"seven" makes me so sad
― horseshoe, Tuesday, 6 June 2023 14:36 (three years ago)
just driving in my car, listening to "folklore," feeling feelings
some of her best lyrics ever on this album.― horseshoe, Tuesday, June 6, 2023 9:30 AM (three minutes ago) bookmarkflaglink
― horseshoe, Tuesday, June 6, 2023 9:30 AM (three minutes ago) bookmarkflaglink
100%. I love all the callbacks/internal references in the lyrics between these two albums. Been listening to this playlist a lot that combines them "in the story order"
https://open.spotify.com/playlist/3IWCfag3xFRuQCtLirPTjP?si=e56567854f9b4306
Here's a decent/consumable summary of the mostly fan-driven narrative on this: https://lhstomtom.org/5235/arts-entertainment/a-detailed-guide-to-folklores-love-triangle-explained-through-some-of-taylor-swifts-folklore-and-evermore-songs/
― Indexed, Tuesday, 6 June 2023 14:36 (three years ago)
until i pick my daughter up and she makes me play songs sung by Elmo
― horseshoe, Tuesday, 6 June 2023 14:37 (three years ago)
xp
Still obsessed with "Cowboy Like Me." The soft "ch" sounds in the lines "perched in the dark / telling all the rich folks anything they wanna hear" ... ugh.
― Indexed, Tuesday, 6 June 2023 14:40 (three years ago)
I mean, yeah, the Evermore songs are on another level…For me, Folklore has a similar hit-to-miss ratio as, say, Lover (in fact I slightly prefer that one)… whereas her best albums are no-skip affairs.
― Day 1 fan (morrisp), Tuesday, 6 June 2023 14:41 (three years ago)
― brimstead, Tuesday, 6 June 2023 19:20 (three years ago)
lol sorry I just thought that was a pretty heavy song
I don't really get how it deepens one's appreciation of these songs by shoehorning them into this supposed "narrative," rather than doing the opposite (making the songs seem more trivial)... but to each their own! (It reminds me of how some Fiery Furnaces fans kept trying to find/invent a narrative throughline to each of their albums, even though that was only sort of / halfway / not at all a thing for all but one of them.)
― Day 1 fan (morrisp), Tuesday, 6 June 2023 19:25 (three years ago)
WHAT― brimstead, Tuesday, June 6, 2023 3:20 PM (six minutes ago) bookmarkflaglink
I dunno! I find the speaker boring and smug! The slightest of the “cardigan” “August” “betty” triptych. Also “you drew stars around my scars” a rare lyrical misstep on the album
― horseshoe, Tuesday, 6 June 2023 19:38 (three years ago)
I still listen to it though
furthermore
IF IM DEAD TO YOU WHY ARE YOU AT THE WAKE?
― horseshoe, Tuesday, 6 June 2023 19:39 (three years ago)
CURSIN MY NAME
WISHIN I STAYED
― horseshoe, Tuesday, 6 June 2023 19:40 (three years ago)
LOOK AT HOW MY TEARS RICOCHET
recently got this on vinyl
still true:
― sleeve, Friday, July 24, 2020 10:58 PM
― broken breakbeat (sleeve), Tuesday, 6 June 2023 19:40 (three years ago)
yeah that’s a great song
― horseshoe, Tuesday, 6 June 2023 19:41 (three years ago)
I don't think the narrator of "Cardigan" is smug(?), and I think some of the lines are really good (particularly how it hinges on the climactic "'Cause I knew everything when I was young")
― Day 1 fan (morrisp), Tuesday, 6 June 2023 19:51 (three years ago)
I really like both couplets in the chorus, too
― Day 1 fan (morrisp), Tuesday, 6 June 2023 19:52 (three years ago)
This may be a #ControversialOpinion, but I think "Cardigan" is even a better/more interesting song than "All Too Well," thanks to its precision and economy.
― Day 1 fan (morrisp), Tuesday, 6 June 2023 19:57 (three years ago)
I guess what I mean is there’s an interesting complexity to the personae speaking “August” and “Betty” even though the dude in the latter seems kind of…feeble, but there me not much TO the persona speaking “cardigan”
― horseshoe, Tuesday, 6 June 2023 19:58 (three years ago)
“Mary’s Song” or “Love Story” or even “invisible string” do a better job conveying childlike conviction you and someone else were made for each other. It sits kind of uneasy on this adult album about self awareness and compromise and the passage of time.
― horseshoe, Tuesday, 6 June 2023 20:01 (three years ago)
would not occur to me to compare “cardigan” to “all too well”
― horseshoe, Tuesday, 6 June 2023 20:03 (three years ago)
They're both post-breakup songs in which the narrator focuses on small, specific details (no?)
― Day 1 fan (morrisp), Tuesday, 6 June 2023 20:13 (three years ago)
Isn’t “cardigan” post-reunion?
― horseshoe, Tuesday, 6 June 2023 20:15 (three years ago)
yeah, I guess the guy comes back in "Cardigan"
― Day 1 fan (morrisp), Tuesday, 6 June 2023 20:16 (three years ago)
― Day 1 fan (morrisp), Tuesday, June 6, 2023 3:57 PM (thirty-four minutes ago) bookmarkflaglink
It's not
― the dreaded dependent claus (Alfred, Lord Sotosyn), Tuesday, 6 June 2023 20:32 (three years ago)
lol agreed, Alfred
― horseshoe, Tuesday, 6 June 2023 20:40 (three years ago)
yeah that’s a bridge too far cmon now
― brimstead, Tuesday, 6 June 2023 21:21 (three years ago)
here we are again
― brimstead, Tuesday, 6 June 2023 21:22 (three years ago)
I remember it all too well!
― the dreaded dependent claus (Alfred, Lord Sotosyn), Tuesday, 6 June 2023 21:28 (three years ago)
Tired: "We're dancin' 'round the kitchen in the refrigerator light"Wired: "Dancin' in your Levis / Drunk under the streetlight"
― Day 1 fan (morrisp), Tuesday, 6 June 2023 21:43 (three years ago)
I think part of the point of “Cardigan” is that for all the narrator’s professed certainty she leaves entirely unclear whether she actually takes dude back. He “comes back” to her, standing in the porch light etc., but it’s entirely possible that she tells him to fuck off at that point.
― Tim F, Tuesday, 6 June 2023 21:59 (three years ago)
yes I suppose that’s true, and I don’t think the song is bad, but it is my least fave on an excellent album.
― horseshoe, Tuesday, 6 June 2023 22:03 (three years ago)
but since I’ve been listening to the album twice a day of late, it may grow on me
― horseshoe, Tuesday, 6 June 2023 22:13 (three years ago)
I love the couplet “knew I’d curse you for the longest time / chasing shadows in the grocery line”, not sure if those two lines are supposed ti be ‘linked’ but yeah they convey that sense of ambiguity about how she feels about dude also “I knew EVERYTHING when I was young” breaks my heart for some reason
― brimstead, Wednesday, 7 June 2023 00:15 (three years ago)
Yeah I think it's more interestingly ambiguous/complicated than one of her more straightforward "we were made for each other" songs...
― Day 1 fan (morrisp), Wednesday, 7 June 2023 00:20 (three years ago)
Yes, the key aspect of the "EVERYTHING" is not that she knew he would come back to her, but that she knew (or anticipated) that he would leave her (and leave her devastated) in the first place. The "they" in "When you are young they assume you know nothing" could be the world at large but it could also be anyone she dated including the "you" of the song. She was clear-eyed enough to know he would ultimately betray her sooner or later, but let it happen anyway because what are you supposed to do when you are in love?
The song I pair it with is not "All Too Well" or "Mary's Song" or "That's How You Get The Girl" or "Love Song" or "Invisible String"; it's "Fifteen". That song is about the illusions of youth: "When you're fifteen and somebody tells you they love you, you're gonna believe them."
But the narrator of "Cardigan" doesn't necessarily believe. Even the chorus is rife with ambiguity: "You put me on and said I was your favourite". Does she actually accept that she is his favourite? Or is it just something she allows herself to accept in the moment because it's comforting?
A key aspect of Taylor's best songwriting on Folkore and Evermore is the way she plays with this kind of ambiguity, and I wish it was talked about more (and that some interviewer would ask her about it, or really ask any intelligent question about her songwriting - but I've griped about that before). Almost all of her best songwriting in this era - "August", "Cowboy Like Me", "Ivy", "'Tis The Damn Season", "Tolerate It", etc. - occupies this space where choosing (or allowing oneself) to be emotionally dependent on another person is fraught with risk and/or sacrifices (variously: autonomy, security, a clear sense of independent self-worth) and even a song like "Cowboy Like Me", which from a distance sounds like a love song, becomes more complicated when viewed up close: "I'm waiting by the phone like I'm sitting in an airport bar", "We could be the way forward, and I know I'll pay for it", "forever is the sweetest con". There's an undercurrent at work which I suspect is a deliberate disavowal of the kind of fairy tale predestination her songwriting is typically associated with (but which she's been moving away from since at least her third album).
(even "Invisible String" is kind of the opposite of how it appears on the surface: "Isn't it just so pretty to think..." The narrator's saying it's a comforting fiction, she knows that in reality life just isn't that simple or straightforward, which is why she now sends presents to the babies of her ex-lovers, but imposing structured narratives is part of how make sense of a deal with the messiness of real life)
― Tim F, Wednesday, 7 June 2023 01:23 (three years ago)
Also hard to hear “Isn’t it pretty to think…” and not be reminded of the final line of that Hemingway novel.
― Day 1 fan (morrisp), Wednesday, 7 June 2023 01:58 (three years ago)
I've never really listened to much Taylor Swift on purpose (for starters, in this house I don't have a choice), but whenever I hear stuff from "Folklore" it clicks that this is the album I've always wanted Taylor to make. Really lovely songs, strong lyrics, really confident in its commitment to a mood minus a lot of the try-hard vibes that sometimes turn me off.
― Josh in Chicago, Friday, 23 June 2023 15:45 (three years ago)