― pdf (Phil Freeman), Monday, 2 January 2006 03:01 (twenty years ago)
― pdf (Phil Freeman), Monday, 2 January 2006 03:02 (twenty years ago)
I've been listening to Mirand Sex Garden's "Fairytales of Slavery" lately, and it sounds like something out of the world of "post black metal." Last time I heard the album, some years ago, it never occured to me that it was a bit on the metallic side, but hearing it again it sees pretty metal. I suppose at the time it would have been considered Swans influenced, but now I can't help but to think it sure sounds a lot like Beyond Dawn. Not terribly surprising.
― James Slone (Freon Trotsky), Monday, 2 January 2006 04:16 (twenty years ago)
― James Slone (Freon Trotsky), Monday, 2 January 2006 04:24 (twenty years ago)
BM is stuff i've never been into but for some reason I like the above bands. Same with th BM influence of the new album by Sunn o))), I like that too. Then again I do like Sunn o))) anyway.
Oh and I liked that Lurker Of Chalice album.
― Last Of The Famous International Pfunkboys (Kerr), Monday, 2 January 2006 04:27 (twenty years ago)
angelblood's got good songs here and there on their first two, their last real cd release was great and more consistent (i'm attributing it to the orthrelm dude playing guitar, even though orthrelm irritates the shit out of me).
as for the rest of the "ha ha let's dress up and play black metal" stuff like the 'funeral folk' collective, haven't heard them. don't think i want to.
― el sabor de gene (yournullfame), Monday, 2 January 2006 09:19 (twenty years ago)
― pdf (Phil Freeman), Monday, 2 January 2006 16:59 (twenty years ago)
Messiah's vocals have always been the best part of the Candlemass sound. That album was probably the nicest surprise (for me, anyway) of 2005.
― a. begrand (a begrand), Monday, 2 January 2006 18:22 (twenty years ago)
http://sammath-naur.blackmetal.it/modules/catalog/images/hellhammer-sh.JPG
― Ian Christe (Ian Christe), Monday, 2 January 2006 20:21 (twenty years ago)
I hope Nortt will do something as well, tour for instance
― rizzx (Rizz), Monday, 2 January 2006 20:28 (twenty years ago)
There are only two choices:
http://www.blastitude.com/6/pettibon-elvis.jpg
or
http://www.ebtm.com/content/ebiz/ebtm/invt/mastp0026/mastp0026_l.jpg
― pdf (Phil Freeman), Monday, 2 January 2006 20:57 (twenty years ago)
― George the Animal Steele, Monday, 2 January 2006 21:09 (twenty years ago)
Also, Angelblood is a really bad joke. They're the reason I don't do drugs, because I wouldn't want to accidentally find them interesting. There's one song where they open with "I AM THA HUNTA!" but it's not the Bjork song. Like, why?
― Whiney G. Weingarten (whineyg), Monday, 2 January 2006 21:14 (twenty years ago)
― who cares wins, Tuesday, 3 January 2006 00:59 (twenty years ago)
― baked beans (Royal Bed Bouncer), Tuesday, 3 January 2006 01:12 (twenty years ago)
And Lucifer's -666- which is an amateur's work from the voluminous catalog of desparation administered by CD Baby. The title song is excellent, along with "Crush Your Enemy" and a love ballad.
― George the Animal Steele, Saturday, 7 January 2006 17:59 (twenty years ago)
I liked it.
― pdf (Phil Freeman), Saturday, 7 January 2006 20:28 (twenty years ago)
― George the Animal Steele, Saturday, 7 January 2006 21:07 (twenty years ago)
also, who is who on this pic http://www.decibelmagazine.com/features/jan2006/twilight.aspx
great article about twilight. some hilarious quotes
― rizzx (Rizz), Saturday, 7 January 2006 21:12 (twenty years ago)
― pdf (Phil Freeman), Sunday, 8 January 2006 21:31 (twenty years ago)
― rizzx, Monday, 9 January 2006 09:16 (twenty years ago)
Damn, George, I need to hear this (and Copperhead too.)
I'm experiencing a metal drought so far this year, I think. (I guess Lullacry's new Finnish goth-pop metal album is tolerable, though. Whether it has anything to do w/ metal is another question entirely.)
And I guess I don't hate the EP I heard by these guys:
http://yearlongdisaster.com/
Can't get more enthusiastic about anything than that yet, though.
― xhuck, Monday, 9 January 2006 16:37 (twenty years ago)
― xhuxk, Monday, 9 January 2006 16:44 (twenty years ago)
The Onkel Tom is done by some guy who is in Sodom, a thrash band I never listen to. Half of it is recorded at Wacken, that place where everyone in a US classic metal band wants to play because it's the go to festival gig for audiences that like it. The kind of omnibus show that makes Rose Tattoo kings for a week or a day or an hour or something. Everyone is shouting "Onkel Tom! Onkel Tom! Onkel Tom" which reminds me of the Bose Onkelz, a kind of average Deutsch oi band from way way back. Whatever happened to Slime! I had two of their records. When they were in storage my mom threw 'em out when she lost her mind to dementia, just before she had to be put in a place for the middle-class decrepit. "You told me to do it," she said.
Speaking of RT, also have Doomfoxx which I haven't had a chance to allot attention. Must be slang for Dumbfucks, I suspect, and it's the thing of one of the guitarists from the Tatts. Might be good, could also be wretched. I'll let you know. Claims to have played a few times in NYC.
Others to listen to on the digital pile this week -- Nikki Puppet, Weinhold and Saeka, all of whom seem to be fronted by vimmen. All 2005 or older prospects who just made it to me, again generally only reviewed in foreign language Euro pubs online and off. Saeka's a hot-looking Japanese girl looking like (or maybe not) fronting an Accept-like band of Deutscher ringers.
― George the Animal Steele, Monday, 9 January 2006 22:35 (twenty years ago)
― George the Animal Steele, Monday, 9 January 2006 22:44 (twenty years ago)
― who cares wins, Tuesday, 10 January 2006 00:18 (twenty years ago)
― Ned Raggett (Ned), Tuesday, 10 January 2006 05:34 (twenty years ago)
― Ned Raggett (Ned), Tuesday, 10 January 2006 05:35 (twenty years ago)
That's what I like best about the album, there seems to be an even balance between the various styles. Fans bitterly complained that their last album was more mainstream-oriented (I liked it), but the new one dips into the late-90s melodic death riffs more.
― a. begrand (a begrand), Tuesday, 10 January 2006 05:45 (twenty years ago)
Not being able to compare it to the previous album I can't get a sense of what mainstream complaints there were but personally I'm glad as heck they let wossname the singer step back from hyperscreech at least part of the time.
― Ned Raggett (Ned), Tuesday, 10 January 2006 05:48 (twenty years ago)
― rizzx, Tuesday, 10 January 2006 08:04 (twenty years ago)
Yeah, the singer took the more clean, melodic approach, which annoyed the fans who still cling to the band's mid to late-90s albums, as well as going for the goth/industrial/nu sounds you mentioned. I thought Soundtrack to Your Escape was a rather daring departure, but I remember the reaction of fans online was split, they either loved it or despised it.
― a. begrand (a begrand), Tuesday, 10 January 2006 08:39 (twenty years ago)
― chuck, Tuesday, 10 January 2006 14:09 (twenty years ago)
samples here: http://www.absolutesteel.com/
(The "Opus Suite" is some fun, lemme tellya.)
― scott seward (scott seward), Tuesday, 10 January 2006 14:21 (twenty years ago)
― Mike Dixn (Mike Dixon), Tuesday, 10 January 2006 19:23 (twenty years ago)
― Edward III (edward iii), Tuesday, 10 January 2006 21:20 (twenty years ago)
In other news, The Ocean's Aeolian is much better than Ocean's I Forget The Title, so I think they oughta have exclusive rights to the name from now on. (Just like Esoteric, the UK doom band, oughta cease-and-desist the shitty metalcore outfit The Esoteric right out of existence.)
― pdf (Phil Freeman), Tuesday, 10 January 2006 21:28 (twenty years ago)
― a. begrand (a begrand), Tuesday, 10 January 2006 22:33 (twenty years ago)
― xhuxk, Wednesday, 11 January 2006 15:24 (twenty years ago)
Seen HoF twice and the answer is a resounding YES.
― Last Of The Famous International Pfunkboys (Kerr), Wednesday, 11 January 2006 15:46 (twenty years ago)
I prefer Ocean - 'Here Where Nothing Grows' myself.
― Last Of The Famous International Pfunkboys (Kerr), Wednesday, 11 January 2006 15:47 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 11 January 2006 15:55 (twenty years ago)
― a. begrand (a begrand), Wednesday, 11 January 2006 22:02 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 11 January 2006 22:03 (twenty years ago)
Another top moment is the song about the plan to drug her, fuck her and pass her to your brother, I'm starting on a career of evil, or something. The one right after it, "Abandon All Hope," is the philosophy of having promiscuous sex with all the girls he can while sponging off their assets. He's over the top in trying to convince he's the world's foulest rock 'n' roll dirtbag. And it's more often than not entertaining, although not always for the right reasons. Not a classic by any means, but good for a few weeks and you can remember the song titles and the songs that go with them.
Weinhold's From Heaven Through the Earth To Hell is Deutsch. It's the bag of Jutta Weinhold, someone not at all like Doro. She is said to have once sang back-up for Amon Duul on tours. This, though, is valkyrie muzik, loud and vigorous German power rock. Songs -- "Blues Metal," "Rock of Metal," "Black Bone Song," "Wounded Pioneer" -- so you know they don't give a shit about English language cred und verstehen Sie, although it's all auf Englisch. "Black Bone Song," whatever it's about, is great. Es ist nicht schrechlich, Jutta! Sie sind eine grosse fraulein!
― George the Animal Steele, Wednesday, 11 January 2006 22:21 (twenty years ago)
― DJ Martian (djmartian), Wednesday, 11 January 2006 22:38 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Wednesday, 11 January 2006 23:01 (twenty years ago)
AborymAgallochAge of SilenceAnataAnathemaAncient RitesBatteredBloodbathBurnt by the SunCallistoCarpathian ForestCave inCeltic FrostCult of LunaDark FortressDarkthroneDaylight DiesDead to FallDecapitatedDimmu BorgirDisillusionDissectionDødheimsgardDrudkhDysrhythmiaEnslavedEntombedEpoch of UnlightEyes of FireFrantic BleepThe GatheringHead Control System [Garm's new band]IlldisposedInto EternityIsisKataklysmKatatoniaKayo DotKeep of KalessinLacuna CoilLegionMadder MortemMastodonMayhemMercenaryMisery IndexMoonspellNegura BungetNeurosisNightingaleNortherNovembreQueensrÿcheRed HarvestRushSaturnusSatyriconScar SymmetryScarveSepulturaSolefaldTexturesThornsThundraTomahawkToolDevin TownsendType O NegativeUnearthly TranceUnexpectVirgin BlackVoivodWhile Heaven WeptWindsWoods of YpresYakuzaYyrkoon
also according to link above from Jaxijin
TroubleSimple Mind Condition (2006)AVAILABLE MARCH 2006!The first release from pioneering doom metallers Trouble in 10 years!! Hopefully Eric Wagner and co. will deliver the goods!!
What else is due out in 2006?
What are your top [10] most anticipated releases?
― DJ Martian (djmartian), Wednesday, 11 January 2006 23:04 (twenty years ago)
― George the Animal Steele, Wednesday, 11 January 2006 23:13 (twenty years ago)
Right now, it's Trouble, The Gathering, Voivod, Into Eternity, Amorphis, Kataklysm, Decapitated...
I have a morbid fascination with the upcoming Queensryche. Mindcrime 2 could be a trainwreck.
― a. begrand (a begrand), Wednesday, 11 January 2006 23:54 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Thursday, 12 January 2006 00:01 (twenty years ago)
hmm, those do sound promising (though are the gathering even remotely metal at all anymore? they crossed a line at some point in the past couple years. don't want to say they've jumped the shark, but that's possible too.) (also, is voivod sans piggy still voivod?)
by the way, please do not construe my uncle billy's smokehouse post above to imply that i have any use at all for either nickelback or alice in chains, because i don't. but there's *something* in these guys' sound (the low vocal notes? the melodies?) that reminds me of that sort of despised (by me and others) post-grunge crapola. except...they're really really good at it. and again, they don't *sound* grunge. press materials compare them to led zep (which makes no sense) and black crowes (which might, but i like this album more than anything i've ever heard by black crowes.) and i'm not kidding about the CMT viability thing; it's as if they've imagined mid 70s hard rock and 1991 power ballads as a way toward, say, rascal flatts fans. and yeah, rascal flatts suck too. but i bet their fans, and nickelback fans, would like these guys. which is a neat and difficult trick, to make good music that could lure an crowd whose favorite music othetwise stinks. good luck to them.
― xhuxk, Thursday, 12 January 2006 01:24 (twenty years ago)
― xhuxk, Thursday, 12 January 2006 01:27 (twenty years ago)
― Mr Straight Toxic (ghostface), Thursday, 12 January 2006 01:41 (twenty years ago)
― xhuxk, Thursday, 12 January 2006 01:44 (twenty years ago)
i'll believe that new celtic frost album when i see it.
i can't wait for katatonia. i'll look forward to isis. and enslaved.
― scott seward (scott seward), Thursday, 12 January 2006 01:47 (twenty years ago)
and oh yeah, george is gonna hate this, but hard as i try, i can't bring myself to hate The Sword.
I haven't heard the entire album yet, but I ecpect to like this one more than early Man. The three songs of theirs I've sampled from their website are good (especially "Iron Swan"), it's more in the vein of High on Fire/Sleep than the NWOBHM stuff that Early Man does.
― a. begrand (a begrand), Thursday, 12 January 2006 01:53 (twenty years ago)
― scott seward (scott seward), Thursday, 12 January 2006 01:58 (twenty years ago)
Trouble kind of got heavy psychedelic, which I liked. Among my favorite things by them were covers of "The Porpoise Song" and "Atlantis."
Weinhold's "Wounded Pioneer" was also grooving me this afternoon. Jutta sings "I was a pioneer!" over a kind of grandiose AOR cock rock lick and you know, she means or meant it. A way overproduced metal record, just what it needed, it seems. This week I'm Deutschland-philic for sure. It cracks me up on the one live cut on the record, Jutta combines English and German in every sentence, like "Ein bischen louder?!?"
(and probably nobody will hear it)
Well, I was intrigued by the blurbs you've been furnishing. But their promo distribution is probably dreadful, right?
― George the Animal Steele, Thursday, 12 January 2006 02:02 (twenty years ago)
That Onkel Tom schlagermetal album is the law. Sodom were in New York last Sunday, part of their exhausting five-date north american tour. They're shameless crowd-pleasers, showering a devoted metal purist crowd with songs about wine, wenches, vietnam, and masturbating to kill yourself. But they're awesome! They're the PlayStation to Immortal's PlayStation 2, and the Seinfeld to Darkthrone's Curb Your Enthusiasm. And between lyrics like "Black metal is the game I play" and "Napalm in the Morning," they fucking cover "Surfin' Bird!" I guess they made their mark in 1985, and it's been a gravy life ever since. SODOM!!
I forgot Early Man wasn't called Girly Man.
― Ian Christe (Ian Christe), Thursday, 12 January 2006 02:42 (twenty years ago)
― ng-unit, Thursday, 12 January 2006 03:45 (twenty years ago)
― ng-unit, Thursday, 12 January 2006 03:47 (twenty years ago)
― James Slone (Freon Trotsky), Thursday, 12 January 2006 04:18 (twenty years ago)
― xhuxk, Thursday, 12 January 2006 13:49 (twenty years ago)
― xhuxk, Thursday, 12 January 2006 14:01 (twenty years ago)
― xhuxk, Thursday, 12 January 2006 14:15 (twenty years ago)
Deicide are putting out a DVD on Earache.
― Edward III (edward iii), Thursday, 12 January 2006 14:34 (twenty years ago)
Well, on their long-lost debut EP on Rabid Cat they did, I guess (and the "Damned for All Time" cover on the followup).
"One Good Man" by Uncle Billy's Smokehouse appears to concern Noah, of Ark fame. So yeah, Christian hard rock, apparently.
― xhuxk, Thursday, 12 January 2006 14:49 (twenty years ago)
― xhuxk, Thursday, 12 January 2006 14:57 (twenty years ago)
Red Swan, huh? You're saying they're good?
― Edward III (edward iii), Thursday, 12 January 2006 15:11 (twenty years ago)
"The Sweater" on the Uncle Billy's Smokehouse CD (chorus hook: "ice is always better than soaking in sweat") sounds pretty eccentric; reminds me of Crack the Sky, actually (and not just because they sang about ice too.) So not all the songs are Christian, at least not in a way I can recognize. And "Takes That Much More" has another great guitar solo. And there's plenty of boogie. And the GnR parts are more Use Your Illusion than Appetite--too bad, but I can live with it.
― xhuxk, Thursday, 12 January 2006 15:18 (twenty years ago)
― pdf (Phil Freeman), Thursday, 12 January 2006 15:49 (twenty years ago)
― xhuxk, Thursday, 12 January 2006 15:50 (twenty years ago)
― xhuxk, Thursday, 12 January 2006 15:54 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Thursday, 12 January 2006 16:31 (twenty years ago)
Haha. I read that and that got me interested in playing The Sword again so I did but it didn't help. The point of the story was that they now have something or had something that appeared to look exactly like an auroch but they couldn't tell if it actually was an auroch and thought it probably wasn't because it didn't act like the ones in the historical record. Which is why people were getting excited about the recovery of some elements of quagga DNA, something they could never have for the auroch.
Anyway, seems to me quagga and aurochs make good subject matter for metal tunes. Probably, usually.
― George the Animal Steele, Thursday, 12 January 2006 16:39 (twenty years ago)
almost every song on the new TNT album would have been perfect for Roxette.
― scott seward (scott seward), Thursday, 12 January 2006 16:45 (twenty years ago)
Hey xhuxk (and anyone else who cares) - You check out this new Sigh disc Shadow Gallery? I like it and it almost made my Top Ten of last year... It sounds like Fraggle Rock doing Power Metal (to be fair, a friend used this description but it works).
― Brian O'Neill (NYCNative), Thursday, 12 January 2006 17:10 (twenty years ago)
40 Taint - The Ruin Of Nova Roma39 Arch Enemy - Doomsday Machine38 Every Time I Die - Gutter Phenomenon37 Arcturus - Sideshow Symphonies36 System Of A Down - Mesmerize/Hypnotize35 Pelican - The Fire In Our Throats Will beckon The Thaw34 The Black Dahlia Murder - Miasma33 Clutch - Robot Hive32 Napalm Death - The Code Is Red, Long Live The Code31 Strapping Young Lad - Alien30 Ulver - Blood Inside29 Unsane - Blood Run28 Capricorns - Ruder Forms Survive27 Nevermore - This Godless Endeavour26 God Forbid - IV: Constitution Of Treason25 Municipal Waste - Hazardous Mutation24 Reverend Bizarre - II : Crush The Insects23 < code > - Nouveau Gloaming22 1349 - Hellfire21 Primordial - The Gathering Wilderness20 Sunno))) - Black One19 Gojira - From Mars To Sirius18 High On Fire - Blessed Black Wings17 Earth - hex (or Printing In The Infernal Method)16 Judas Priest - Angel Of Retribution15 Blut Aus Nord - Thematic Emanation oF Archetypal Multiplicity14 Sigh - Gallows Gallery13 Bolt Thrower - Those Once Loyal12 Witchcraft - Firewood11 Nile - Annihilation Of The Wicked10 Red Sparowes - At The Soundless Dawn09 Akercocke - Words That Go Unspoken, Deeds That Go Undone08 Candlemass - Candlemass07 Burst - Origo06 The Axis of Perdition - Deleted Scenes From The Transition Hospital05 Opeth - Ghost Reveries04 Deathspell Omega - Kenose03 Cathedral - Garden Of Uneearthly Delights02 Jesu - Jesu01 Meshuggah - Catch Thirty Three
― Last Of The Famous International Pfunkboys (Kerr), Thursday, 12 January 2006 17:16 (twenty years ago)
How do the urban slum metal trades only focus on a certain few labels that issue rigidly within the subgenres stylemuzik and miss all the hundreds of records that come out each year that are also metal or at least half so, or which rock just as much, sometimes less, sometimes a lot more? I can't figure it out.
― George the Animal Steele, Thursday, 12 January 2006 17:25 (twenty years ago)
― Hairy Asshurt (Toaster), Friday, 13 January 2006 15:06 (twenty years ago)
On the other hand is there really a band called < code >?
― xhuxk, Friday, 13 January 2006 15:12 (twenty years ago)
― sympathy for the underdog (blackmail.is.my.life), Friday, 13 January 2006 15:14 (twenty years ago)
http://rateyourmusic.com/artist/code
joint Norwegian/ British black metal group
...but the brackets are closer to the band name
― DJ Martian (djmartian), Friday, 13 January 2006 15:16 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Friday, 13 January 2006 15:22 (twenty years ago)
You mean they should just be called < > . A wee joke.
― George the Animal Steele, Friday, 13 January 2006 16:53 (twenty years ago)
Its [sic] time again to get your dancing shoes on & prepare to shake that rump for the Eagles of Death Metal are set to release their much anticipated sophomore full-length "Death By Sexy" on April 11th, 2006 via Downtown Recordings.
Eagles have just completed a video for their first single "I Want You So Hard (Boys Bad News)" in Los Angeles. Directed by the hotter than hell "Lonely Island" (think Narnia rap/SNL writers)...With Jack Black, Dave Grohl, and other Eagles member Josh Homme also starring in the video, this is one for the whole family to enjoy!
― George the Animal Steele, Friday, 13 January 2006 17:55 (twenty years ago)
Looks even worse to me. Though the Hives inclusion is kinda cute. (Actually, I don't really mind the Terrorizer one above. But I agree with George that its metal definition seems pretty rigidly defined.)
― xhuxk, Friday, 13 January 2006 18:02 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Friday, 13 January 2006 20:11 (twenty years ago)
Another thing fucked about these lists is that they're self-reinforcing. They ask you to entertain the stupid idea that the 'zines are right at the cutting edge of something, while in practice they're reviewing and interviewing a couple hundred bands per year who are recorded within a bubble of specialty labels characterized by a micro-brand name within the genre and narrowly shared tastes. If you get the promotional materials, it's oftenbaldly obvious. You get a thin phonebook sheaf of blurb and magcopy in which the same people and publications say the same thingover and over. Now a certain degree of repetition is always around, even acceptable, but really, to make it a benchmark is ridiculous.
Anyway, from the inside, it looks like there is a lot ofvariety. From the outside, it looks like there is very little.(Practically speaking, "metal" isn't the only genre that suffers from this type of thing.) "No Depression" and "punk rock," anyone?
― George the Animal Steele, Friday, 13 January 2006 20:48 (twenty years ago)
>Riverside, *Simple Life* ("formerly called 'Riverside Avenue', cdbaby says; I do believe that's an REO Speedwagon reference), four burly beer-bellied middle-aged guys from Missouri who look like roofers or plumbers, including one in an AC/DC shirt and one African American; mainly do a choogle that boogie-woogies at times but that'd kick more if actual money could be spent producing their album, but they also take stopoffs in Sabbath-via-Joan Jett metal ("I Got This Funny Feeling")... By "Sabbath via Joan Jett metal" I mean that they're clearly trying to make the music apocalyptic a la Ozzy, but the riff reminds me more of "I Love Rock and Roll" than "Ironman." As opposed to the opening riff on the album, which reminds me of "Summer of 69" by Bryan Adams... And duh, to increase the stamina and kick quotients, all I had to do is turn the volume up. These old guys kick fine. Riff in "We've Been Rockin" comes from AC/DC's "It's a Long Way To the Top.")
― xhuxk, Friday, 13 January 2006 21:09 (twenty years ago)
― George the Animal Steele, Friday, 13 January 2006 21:18 (twenty years ago)
And I would have mentioned the next item for They Phoned It In but it was too short. Anyhow, last weekend, the LA Times Sunday section prints the howler that Kerrang has more "women" as readers than guys. I'm not sure what the purpose of it was. Either of the following (1) to insult the intelligence of readers, (2) to serve as notice that even the most ridiculous quotes could be published verbatim as long as it comes from a business interest, like the owner, (3) to insult the intelligence of readers, (4) because faleshoods in print are the spice of life.
― George the Animal Steele, Sunday, 15 January 2006 20:52 (twenty years ago)
http://www.decibelmagazine.com/features/feb2006/top50.aspx
― scott seward (scott seward), Monday, 16 January 2006 17:53 (twenty years ago)
Most metal tracks on the (imminent) new Shooter Jennings: "Electric Rodeo," "Bad Magick."
Why are Cult of Luna (whose previous album was an utter bore) in the headline of that Decibel link anicipated album list piece but not on the actual list? I'm confused.
― xhuxk, Monday, 16 January 2006 18:17 (twenty years ago)
do you agree with what i wrote above about the tnt album, chuck? that a lot of the songs would be perfect for roxette? i really did think of them when i listened to that album.
― scott seward (scott seward), Monday, 16 January 2006 18:30 (twenty years ago)
― George the Animal Steele, Monday, 16 January 2006 18:38 (twenty years ago)
http://www.absolutesteel.com/
― scott seward (scott seward), Monday, 16 January 2006 18:53 (twenty years ago)
that Himsa album is fucking GREAT if you digs the hawudkowah, probably awful if you don't, I wouldn't know: anyhow it's been rocking me all January long
― Mr Straight Toxic (ghostface), Monday, 16 January 2006 19:13 (twenty years ago)
― Dan (Nothing Says "Metal" Like Old Soul Samples And Scratching) Perry (Dan Perry, Monday, 16 January 2006 19:26 (twenty years ago)
Scott, they're so committed to success they done dropped off the 'net. Their domain website name expired on the 11th and reverted to Network Solutions. 'tis gone if the furnished link is correct.
― George the Animal Steele, Tuesday, 17 January 2006 19:13 (twenty years ago)
― scott seward (scott seward), Tuesday, 17 January 2006 19:44 (twenty years ago)
― Zwan (miccio), Tuesday, 17 January 2006 19:52 (twenty years ago)
hey, hey: for neophytes like myself who are still getting their heads round this whole wonderful world of metal that for so long they wrote off, the terrorizer list is a godsend. some of us still have to walk before we can run ...
― grimly fiendish (grimlord), Tuesday, 17 January 2006 22:28 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Tuesday, 17 January 2006 22:35 (twenty years ago)
Don't overlook the value of winging it. Good things sometimes accidentally present themselves to the flailer.
― George the Animal Steele, Tuesday, 17 January 2006 23:02 (twenty years ago)
not sure yet. hopefully. you've reminded me to speak to my pal about this tomorrow.
― grimly flailing (grimlord), Tuesday, 17 January 2006 23:19 (twenty years ago)
― grimly fiendish (grimlord), Tuesday, 17 January 2006 23:31 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Tuesday, 17 January 2006 23:32 (twenty years ago)
http://gritz.net/
― xhuxk, Wednesday, 18 January 2006 00:07 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 18 January 2006 02:45 (twenty years ago)
― George the Animal Steele, Wednesday, 18 January 2006 03:08 (twenty years ago)
― a. begrand (a begrand), Wednesday, 18 January 2006 21:08 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Wednesday, 18 January 2006 21:20 (twenty years ago)
― YetSoFar, Thursday, 19 January 2006 00:27 (twenty years ago)
― xhuxk, Thursday, 19 January 2006 14:13 (twenty years ago)
― xhuxk, Thursday, 19 January 2006 18:00 (twenty years ago)
― xhuxk, Thursday, 19 January 2006 18:01 (twenty years ago)
― xhuxk, Thursday, 19 January 2006 18:05 (twenty years ago)
― Brian O'Neill (NYCNative), Thursday, 19 January 2006 18:06 (twenty years ago)
― xhuxk, Thursday, 19 January 2006 18:14 (twenty years ago)
― pdf (Phil Freeman), Thursday, 19 January 2006 18:24 (twenty years ago)
er..just noticed above that Kerrang named this goofy (though kinda entertaining) Cathedral thing the THIRD best metal album of last year?? Do people really think it's *that* good?? That's kind of nuts.
― xhuxk, Thursday, 19 January 2006 18:38 (twenty years ago)
My favorites were the first, Forest of Equilibrium, Ethereal Mirror, the Hopkins, the Witchfinder EP and the anthology, which duplicates a lot but covers it all pretty succinctly.
Was laughing at another CD Baby thing today, Norselaw -- Viking rap black metal. Stupefying, hilarious descriptions, though I haven't had a chance to listen to it.
More time being spent on Heart Full of Dirt which is fullbore US biker rock, obviously so when you see the cover.
― George the Animal Steele, Thursday, 19 January 2006 19:45 (twenty years ago)
― George the Animal Steele, Thursday, 19 January 2006 19:46 (twenty years ago)
The hip-hop buyer in my store and myself agreed that this and the Necro album where he did songs with guys from Obituary and Nuclear Assault had no target audience to speak of because most of the people who got the inside black metal jokes of Norselaw would hate anything that involved humor or rap and anyone who liked '80s underground metal would hate anything that involved rap and... well, that's enough, really.
This says it all, really...
ihttp://www.reflectionsfilms.com/norselaw/001.jpg
― Brian O'Neill (NYCNative), Thursday, 19 January 2006 20:32 (twenty years ago)
(the one you saw earlier chuck was infact the 2004 one with The Hives in it)
― Last Of The Famous International Pfunkboys (Kerr), Thursday, 19 January 2006 20:37 (twenty years ago)
Anyone know about the apple scented "sniffle discs" that come with the special edition of this album? Apparently there's some kind of dealy on the CD that unleashes an apple scent when heated by the CD player.
― a. begrand (a begrand), Thursday, 19 January 2006 21:40 (twenty years ago)
― pdf (Phil Freeman), Thursday, 19 January 2006 21:48 (twenty years ago)
― sympathy for the underdog (blackmail.is.my.life), Thursday, 19 January 2006 22:27 (twenty years ago)
No, Phil. Don't usually see any Drag City stuff so it's news to me. From Nazareth, a very Pennsylvania Dutch town. Do the Dutch. Wait, that's Steve Brosky (a little joke if you know the area).
There were always metal bands from these little one horse stations. Generally, they made their own records and the vinyl died there.However, they would sometimes have the moxie to send their stuff to Kerrang which would review bands like the Sterling Cooke Force -- who were from Tamaqua, I think, and another trio, and Vicious Barreka, who -were- from Allentown/Bethlehem. They'd get four or five stars and that still couldn't get them arrested anywhere, unfortunately.
― George the Animal Steele, Thursday, 19 January 2006 23:04 (twenty years ago)
― George the Animal Steele, Thursday, 19 January 2006 23:21 (twenty years ago)
― scott seward (scott seward), Thursday, 19 January 2006 23:26 (twenty years ago)
I used to be a student of the sociology eastern PA yokel bands. Live weren't metal but they fit in with poverty-stricken, too, when they were called Public Affection and much less pretentious.
I put locals in my Top Ten last year. A metal band from Hummelstown, Full Moon, who rocked. And my name was even on the cover of a Northampton metalcore band, The Russian Meatsquats. They did the theme from some horror movie, the one with the flying silver ball with knives sticking out of it that went into your head. On Whoopsie-Kerplunk records or something like that.
― George the Animal Steele, Friday, 20 January 2006 00:05 (twenty years ago)
― xhuxk, Friday, 20 January 2006 17:04 (twenty years ago)
― Mr Straight Toxic (ghostface), Friday, 20 January 2006 17:19 (twenty years ago)
There's a major Eastern PA presence in this thread [Boyertown chapter].
― sympathy for the underdog (blackmail.is.my.life), Friday, 20 January 2006 17:24 (twenty years ago)
― pdf (Phil Freeman), Friday, 20 January 2006 17:28 (twenty years ago)
although not too impressed
― rizzx (rizzx), Friday, 20 January 2006 17:30 (twenty years ago)
Was also playing Doomfox loud last night at which point the AC/DC and Rose Tattoo-like parts really slam. That's about .450-.500 percentage-wise, at least.
And I can report Heart Full of Dirt's American Road is a good bookend to Copperhead. A Jim Dandy-like singer carries the tuneage. "Bitch Slap" is a song everyone should know, bitch-slapping idiot SUV drivers, giving them impacted wisdom teeth with a blow upside the head, for hogging the road and blocking your view, is something a lot of people could get behind.
"Innocent Bystander" is about America's aptitude at breeding assassins and "Registered Sex Offender" could be the theme song of O'Reilly or any news show that likes to lead with the latest story of outrage. There's also a tune about a guy who steals gas, so the Harley rider wants to track him down and give him a beating.
All of it is tune-oriented with heavy classic rock guitar and some organ, lots of catch chorusing, so you lurker fans of biker rock will want to look this one up.
― George the Animal Steele, Friday, 20 January 2006 17:30 (twenty years ago)
― xhuxk, Friday, 20 January 2006 17:47 (twenty years ago)
― xhuxk, Friday, 20 January 2006 17:50 (twenty years ago)
Anyway, "Abandon All Hope" and "Look Ma No Hands" are great. "Boyfriend," the second song, is where it really starts cranking. The drummer has the same grooves as the guy in Rose Tattoo and Phil Rudd.
― George the Animal Steele, Friday, 20 January 2006 18:05 (twenty years ago)
It's on Vai's label, F/N, which has specialized in guitar instrumental albums, strong to the hard rock and metal side of things. You know, the consitantly fair to good records that are always ignored when it's time to trot out the cyclical this-isn't-your-dopey-older-brother's-dumbo-metal-no-buddy-this-metal-is-for-smart-people-like-you-so-getta-loud-o-what-I-found-at-Aquarius meme.
Lotsa fusion, lotsa Reid shredding, NO vocals (OO-RAH, good!!), blues-based riffs, reggae-riffs, a couple quieter things to break it up, weird string dragging and bumping on the pickup cover effect that makes it sound like a record skipping, a Tony Williams Lifetime tune covered that fits in well with everything else not stinking up the place or sticking out like a sore thumb. It will get its share of play the rest of January and at least half of February, I think.
― George the Animal Steele, Saturday, 21 January 2006 21:45 (twenty years ago)
>Alligator Stew, *Welcome to Monticello...Live!!!*: Funky Louisiana Southern hillbilly swamp semi-metal cdbaby.com discovery with a singer who sounds like Jim Dandy Mangrum and four other guys with long scraggly hair and mustaches and floppy black turkey-shooting hats. Live tracks are a little loose, being live, where people are probably drinking heavier than one should; I need to listen more to the studio CD they also sent, but that's at work and I'm at home with the live one instead now. "I Know You Too Well" somehow makes me flash on "You Got That Right" by Skynyrd; "You Gotta Give" somehow makes me ditto on "Hot Rod" by Black Oak Arkansas, though with both of em that's more due to the groove than anything else. In fact, though the vocals/guitar/piano are good, what really kills here is the rhythm section. (Though soon as I typed that it went into "The Heist," with a more expansive guitar jam opening than anything on Shooter Jenning's new album, into ballad-tempo words about factories closing: "There's a bank in Lafeyette where we get a loan," by robbing it apparently, just to get what they're rightly owed, but they're caught and wind up on death row; breaks down into parts where there's just singing over sparkling Purple/Uriah organ.) Covers of Seger's "Turn the Page" and CCR's "Green River/Susie Q." Good natured as hell. A keeper for sure, but more time required to gauge just how good it is.
― xhuxk, Sunday, 22 January 2006 00:17 (twenty years ago)
>(Actually turns out the album basically winds down to a few slower spookier tracks than the whiskey party funk it starts out with; theme seems to be My City Was Gone. Last track "Far Beneath the Rubble" ends it all, talks of people lying in pools of blood and rats in the street. Could also be rememberances of a distant battlefield; hard to tell. Same mood as Nazareth's version of "The Ballad of Hollis Brown", though not as noisy.) (And by the way, Copperhead remind me of Nazareth the more I hear them as well, for whatever it's worth.)
― xhuxk, Sunday, 22 January 2006 00:23 (twenty years ago)
― xhuxk, Sunday, 22 January 2006 00:25 (twenty years ago)
― xhuxk, Sunday, 22 January 2006 01:52 (twenty years ago)
― scott seward (scott seward), Sunday, 22 January 2006 01:56 (twenty years ago)
― xhuxk, Sunday, 22 January 2006 02:00 (twenty years ago)
― xhuxk, Sunday, 22 January 2006 02:19 (twenty years ago)
I wonder if the airport will have Decibel. Never got a chance to pick up the January issue..
― Fastnbulbous (Fastnbulbous), Sunday, 22 January 2006 05:42 (twenty years ago)
McLaughlin should have never let him and the rest of the band write matierial for Mahavishnu. Those new agey pop tunes on Inner Worlds are freakin' terrible, a sad end to a great band.
Anyone seen Electric Frankenstein live? They are playing around here weekend after next and I am going to see them. I've got How to Make a Monster, but have never seen them live.
― Earl Nash (earlnash), Sunday, 22 January 2006 06:58 (twenty years ago)
― xhuxk, Sunday, 22 January 2006 16:29 (twenty years ago)
― Ned Raggett (Ned), Sunday, 22 January 2006 19:44 (twenty years ago)
― pdf (Phil Freeman), Sunday, 22 January 2006 20:06 (twenty years ago)
Brent Heath's Boog is another for the lovers of Copperhead. And if you haven't heard Copperhead, it's a must for the heavy classic rock guitar fury in service to catchy tunes. It burns throughout. I can see myself playing it all year.
Anyway, Heath kicks off with "Who Damned the Man," which is stoner rock if stoner rock bands could generally write tunes that might have been on classic FM without the application of liberal doeses of wishful thinking. It's hard, has real grind on the riff, the man plays a mean wah-wah, plus he can sing as good as the song requires to be catchy. You can sing along with parts of it today, or shout. That works good, too. "S.I.N." comes next and it's a potent protest tune that we should stop scorching the earth so our kids, yours maybe, not mine -- I don't have any, will be able to respect us. That's a nice sentiment, great for the number, but I don't see it happening anytime soon.
I'll probably write more Brent Heath's most excellent Boog -- and the songs I'm playing so far are definitely not boog -- later. Another outside the very small box thinker found in the weeds of CD Baby.
― George the Animal Steele, Sunday, 22 January 2006 21:20 (twenty years ago)
Very Sabbath, that sentiment.
― Ned Raggett (Ned), Sunday, 22 January 2006 21:25 (twenty years ago)
This week, a big feature on a hair metal theatre production in LA -- yes, that's right, hair metal -- the musical. I guess it makes a little sense, the city being once the capital of hair metal although one recognizes that the newspaper assiduously avoided saying anything nice about it when it happened. Anyway, HAIR METAL MUSICAL IN 2006 == GOOD at LA Times, BUT, HAIR METAL IN 80's = BAD!!.
The howlers: "To most pop historians [ha-ha, that's like saying "used car salesmen" with a straight face], the bands heard in 'Rock of Ages' [the writer of the piece seems not to pick up the straight reference to Def Leppard] were pea-brained dinosaurs that fed ravenously through the self-indulgent 80's, when they sold tens of millions of albums, but eventually had their comeuppance and extinction from the pop charts in the irony-laced 1990s.
"Millions of dollars in record sales and concert tickets -- as well as countless radio/TV hours -- are wasted on the cartoonish bravado like Motley Crue and Ratt," Times critic Hilburn wrote in 1986, [lamenting] that with 'meaningless pop banality ruling the marketplace, the result is that for the first time since Presley's arrival, serious, hearfelt, radical rock is a minority force."
Ha-ha, I can't stop laughing, help me, please, I've fallen and I can't get up! HAIR METAL MUSICAL = GOOD. REAL HAIR METAL = meaningless, pop banality.
So anyway, HAIR METAL THEATRE for the upper middle class = great, vitamins for your brain! And it even has something to do with Hedwig & the Angry Inch, who were sub-mediocre glam hair metal disguised as something else but loved by the theatre crew. Plus it's a smirking guilty pleasure and they don't slaughter the Nightranger song! Next up, syndication of "Prey for Rock 'n' Roll." Oh, wait.
One of the prime-movers of 'Rock of Ages," or HAIR METAL THEATRE 3000, unnamed because it was so phoned in, at 28 "has established herself as an in-demand LA director of rock musicals both poignant ("bare" about gay teens coming of age at Catholic boarding school [WHAT THE FUCK IS A CATHOLIC BOARDING SCHOOL?! I'M A CATHOLIC AND THE PAROCHIAL SCHOOLS IN ALL THE COUNTIES I GREW UP IN DID NOT BOARD, STUDENTS RODE THE FUCKING BUS JUST LIKE PUBLIC SCHOOL KIDS!!]) and raunchy, "Pussy Cat Dolls" live...
Gonna listen to Weinhold again tonight. Doomfox, more Brent Heath. Shooting Star's Leap of Faith which is two years old but beats the shit out of Bon Jovi's Have A Nice Day. Man, you have to impressed by JBJ's unabashed and relentless shilling of it, first on country channels, then on award shows, and now in ads for videos to your rinky-dinky cell phone.
― George the Animal Steele, Monday, 23 January 2006 02:54 (twenty years ago)
― Thomas Tallis (Tommy), Monday, 23 January 2006 03:26 (twenty years ago)
― rocky, Monday, 23 January 2006 03:38 (twenty years ago)
Hmmm, sounded pretty good to me. One of the Tatts is actually the prime guitarist in the band on the CD I have. The humor is pretty sly, but often drier than the progenitors, so it's easy to miss it. That, or it's often hard to tell when the vocalist is kidding, which only adds to the experience. Maybe the lyricist is too smart for his own good? In any case, the Doomfox CD rocks and packs great Aussie boogie heft when turned up to the same level you'd listen to the Tatts or the Young Bros.
― George the Animal Steele, Monday, 23 January 2006 03:46 (twenty years ago)
― ratty, Monday, 23 January 2006 04:05 (twenty years ago)
Ha-ha. This phrase is an extra-fine howler. Anyone who thinks Eighties metal bands lacked a sense of humor, or the very human capacity to appreciate the comedy of diametric opposites occupying the same space, is essentially ... a moron.
― George the Animal Steele, Monday, 23 January 2006 07:00 (twenty years ago)
― xhuxk, Monday, 23 January 2006 14:24 (twenty years ago)
persephone's dream earlier CD (also mentioned above) *moonspell* (from '99) isn't as rocking as the later one, but is maybe weirder -- lots of moody dead can dance atmospherics, but also parts resembling early '80s rush, an extended drum solo, and folkier ballad stuff toward the end. the woman singer has the new aginess of gathering or lacuna types, but her band looks like they're old prog-metal guys, not death metal guys, a nice change of pace for this kind of stuff.
― xhuxk, Monday, 23 January 2006 16:01 (twenty years ago)
― pdf (Phil Freeman), Monday, 23 January 2006 16:55 (twenty years ago)
And Alligator Stew's ballads intersperse the gunslinger laments with plenty of factory-closing/bank-foreclosing laments, often in the same song. The gunslinging is just a part of the economics of it all.
― xhuxk, Monday, 23 January 2006 17:16 (twenty years ago)
That's brilliant! Need to relisten to that.
― Ned Raggett (Ned), Monday, 23 January 2006 17:17 (twenty years ago)
No way. Doomfoxx come way closer to Rose Tattoo than Wolfmother (whose EP I'm listening to right now) come to Sabbath. I don't think I even would have guessed Sabbath is what Wolfmother were aiming for if you hadn't said so. They sound like a weedy little indie rock band to me - say, Secret Machines wannabees with a Jack White wannabe singing. And Secret Machines aren't even that good. And yeah, I guess a "stoner riff" (trademark symbol here) comes in now and then, but it's like some joke "'70s show" version or something, to my ears. They seem not to know how to rock, just to zoom their churn in the air a bit. Or I got it -- they're part of that Black Mountain/Gris Gris/Warlocks "Hawkwind with the rocking parts taken out" genre maybe?
― xhuxk, Monday, 23 January 2006 19:05 (twenty years ago)
― xhuxk, Tuesday, 24 January 2006 14:54 (twenty years ago)
― xhuxk, Tuesday, 24 January 2006 15:20 (twenty years ago)
"Who Damned the Man" is definitely Xtian, and one of the best, if not the best, lead-off/single metal track I've heard this year so far. Not hard to do, it being only January. Plus there's even a song about the value of "Family."
― George the Animal Steele, Tuesday, 24 January 2006 17:04 (twenty years ago)
I'll have to listen to it straightaway when time presents later today.
Here's a fine history of Chicago's very own M&R Rush. What a name...
http://www.midwestbeat.com/ezine/june%202003/mr_rush.htm
― George the Animal Steele, Tuesday, 24 January 2006 17:20 (twenty years ago)
― pdf (Phil Freeman), Tuesday, 24 January 2006 18:16 (twenty years ago)
If you read the story, that's eggz-ackly what happened! And I have access to one of the albums by Alligator Stew, but it's untitled, BUT appears to be the studio LP. It doesn't have the Seger and CCR covers, but does have two versions of another song mentioned.
― George the Animal Steele, Tuesday, 24 January 2006 19:04 (twenty years ago)
"You're the Only Woman" has the guy singing about he was burned to a crisp by love, can't see, but still loves her. CD Baby strikes! This would also be great on teenpop because it's sure full of pep and big guitars.
― George the Animal Steele, Tuesday, 24 January 2006 22:14 (twenty years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Tuesday, 24 January 2006 22:29 (twenty years ago)
― xhuxk, Tuesday, 24 January 2006 23:12 (twenty years ago)
http://cdbaby.com/new/97?skip=10
Example:
JØE: Rock'n'roll Man
Best rock and roll ever. Think Ted Nugent and AC/DC
― George the Animal Steele, Tuesday, 24 January 2006 23:24 (twenty years ago)
― xhuxk, Tuesday, 24 January 2006 23:59 (twenty years ago)
― xhuxk, Wednesday, 25 January 2006 00:01 (twenty years ago)
― xhuxk, Wednesday, 25 January 2006 00:04 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 25 January 2006 01:03 (twenty years ago)
― George the Animal Steele, Wednesday, 25 January 2006 01:20 (twenty years ago)
― Ned Raggett (Ned), Wednesday, 25 January 2006 01:26 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Wednesday, 25 January 2006 01:30 (twenty years ago)
― Ned Raggett (Ned), Wednesday, 25 January 2006 01:44 (twenty years ago)
― a. begrand (a begrand), Wednesday, 25 January 2006 02:20 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 25 January 2006 02:37 (twenty years ago)
Wow, I had no idea that was her. Weird how the press info doesn't mention that.
― a. begrand (a begrand), Wednesday, 25 January 2006 02:50 (twenty years ago)
― ng-unit, Wednesday, 25 January 2006 03:08 (twenty years ago)
― ng-unit, Wednesday, 25 January 2006 03:11 (twenty years ago)
But back to M&R Rush. First half of album I downloaded was over-the-top twin guitar bubblegum and glammy hard rock. Didn't let up for a second with the songwriting. Second half reveals local band bowing to what was expected of it, maybe at the time in the clubs of Chicago. Turns into a power pop version of Wang Chung or something. The guitars mostly disappear although some of the songwriting remains intact.
The first half is still a major arena-ready blowout though.
Brent Heath's Boog -- the title tune of which I think is about a friend who commits suicide -- grows in stature. Has the same influences as the psychedelic side of Trouble. Trouble were from Chicago, too, right?
Now don't go running off thinking you're getting The Skull, Boog is more Plastic Green Head and Run to the Light. But, anyway, it's not Trouble cloning but it is good songwriting in service of power rock and "Who Damned The Man" has great lyrics, from the protagonist as the sent to Earth saviour, who is asked to take everyone's "broken plans in his broken hands."
― George the Animal Steele, Wednesday, 25 January 2006 03:39 (twenty years ago)
Thanks for hangin in with us, and, we will see you soon.Eric, Rick, Bruce, Oly, Chuck
― Mike Dixn (Mike Dixon), Wednesday, 25 January 2006 04:21 (twenty years ago)
― Brian O'Neill (NYCNative), Wednesday, 25 January 2006 14:47 (twenty years ago)
― scott seward (scott seward), Wednesday, 25 January 2006 15:39 (twenty years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Wednesday, 25 January 2006 16:07 (twenty years ago)
As for M&R Rush, George is right about the album getting a little wimpy in its second half, though "Good-bye Baby" and "Good-bye City Lights" both seem bazooka-rock enough to my ears. Interesting, too, that so many of these guys' most endearing songs (i.e., the ones about Chicago, selling a million records, da Cubs, Christmas, and John Lennon) are also musically their clunkiest. Or maybe it's just they sound dorkier when they move away from absolute cliches in their lyrics. Anyway, my point is that I enjoy their clunkier stuff, too.
― xhuxk, Wednesday, 25 January 2006 16:44 (twenty years ago)
― xhuxk, Wednesday, 25 January 2006 16:53 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 25 January 2006 16:57 (twenty years ago)
http://cdbaby.com/cd/mandrrush
which was their first album. Had "Rock & Roll Chicago" on it, so I thought I had the right one. Didn't see the second which is what you have. Anyway, listen to the song "#1" on the first one. That's damn great and bubblegum glam bazooka f'r sure.
Dorky or not, I really like the original version of "Rock & Roll Chicago," too. My impression is the first half of the premier CD was originally a vinyl EP they'd made and which sent the lead-off song into rotation at a Chicago classic rock station.
Then, if you listen, you'll see how it goes MTV Eighties danceoid Viceoid around "Surgery" and after.
― George the Animal Steele, Wednesday, 25 January 2006 17:00 (twenty years ago)
jeezus, xhuxk, check these euro reviews of the M&R Rush CD.
http://www.mandrrush.com/homepage/contentview.asp?c=127217
Howcum the enthusiasm?
I'll answer: Go to this month's edition of Guitar Player. In it, there is a feature on shredder Michael Angelo. Now, everyone laughs at this in general music journo circles but Angelo actually notes an interesting thing. He says he controls his publishing and now it makes a reasonable living in sales from Europe and the rest of the world.
Quote: "One difference between America and everywhere else is that we got sidetracked by grunge and nu metal. During the 90's, the rest of the world seemed more interested in Dream Theatre than Godsmack, and Kurt Cobain became the poster child for American guitar."
Michael Angelo was in Nitro in the '80's.
So Europe likes different American stuff and if it's swayed by fads, it's way different fads. Jives with me finding reviews of US classic rock and metal homegrown vanity CDs only in foreign language Euro-zines.
― George the Animal Steele, Wednesday, 25 January 2006 18:45 (twenty years ago)
And I was not expecting to like the new Eyes of Fire album as I do. I didn't like their debut very much, but this one is a massive improvement.
― a. begrand (a begrand), Wednesday, 25 January 2006 21:04 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 25 January 2006 21:17 (twenty years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Wednesday, 25 January 2006 22:14 (twenty years ago)
― xhuxk, Thursday, 26 January 2006 18:07 (twenty years ago)
Anyway, outside of the second album -- Strength -- often, their best stuff came later. Annoyingly, the next album I really like was close to the last one, if not the recent last one, done before Frigo up and died. I think it's entitled ?, um, really. In between there's lots of stuff, usually fair to good although a couple clunkers, with substituted lead guitarist and drummers.
Anyway, what you have sounds good. I don't suppose I'll see a copy.
Downloaded Chach's To Destroy Your Boyfriend's Confidence EP. Four songs, starts poor gets better, is best on last tune. From California, slight Roxy Musik into heavy hard influence, glammy and Goth, too. Reminds of Living Things without quite the oomph. It's average but the title of the EP is A plus-plus-plus.
― George the Animal Steele, Thursday, 26 January 2006 18:29 (twenty years ago)
email 'em!
http://www.sciencefictionidols.com/contact.htm
Looks like they're from Pittsburgh, according to the website (just like Povertneck Hilllbillies *and* Persephone's Dream, howbout that?)
― xhuxk, Thursday, 26 January 2006 18:51 (twenty years ago)
Obligatory Link
(Note: He's a college kid, as are all of my writers, so bear that in mind.)
― Brian O'Neill (NYCNative), Thursday, 26 January 2006 19:40 (twenty years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Thursday, 26 January 2006 19:50 (twenty years ago)
I never said that! First album was self-released, I think, and this one may be, too, unless there is actually a label called Monkey Trash Music that I never heard of before.
― xhuxk, Thursday, 26 January 2006 20:19 (twenty years ago)
― Brian O'Neill (NYCNative), Thursday, 26 January 2006 20:23 (twenty years ago)
Anyway, the a write-up from one of the Pittsburgh dailies makes me think they sound like the Hollywood Brats, which -- coincidentally -- I was just listening to over the weekend.
Beginning excerpt, the heart of it sans the needless interview, actually:
Idols' 'ragged guitar rock' comes homeScience Fictions Idols TRIBUNE-REVIEWThursday, December 1, 2005
In a perfect world, the Science Fiction Idols would take a time machine back to the late 1970s. They'd be regulars at CBGB's in New York and the Whiskey A-Go-Go in Los Angeles. They'd hang out with the Rolling Stones and David Bowie, grace the covers of Creem and Trouser Press magazines, There's only one problem with that scenario: Despite a band name that inspires visions of Isaac Asimov penning a story about a rock band, time machines don't exist.
More realistically, the Science Fiction Idols are too young to have tapped into the late '70s rock scene.
"I was 10 in the late 1970s," says drummer Angelo Amantea.
===I'm convinced it's not necessarily to anyone's advantage to be signed, even to a piss-poor indie. The indie gives you distribution, only if you're lucky, and it can connect you with a promo person who sends out review copies that, even if reviewed, probably won't sell any CDs. Plus, you'll get hooked up with a booker who can put you into a thirteen-date across the nation in dives tour with wildly inappropriate acts. You'll show up in town, no one will attend 98 percent of the gigs, and you'll throw your money away on overhead.
Explains why CD Baby is a pretty good place to go to find things. No one is signed.
In a nutshell, I have hard time following why anyone would actually prefer to write about or buy major label and indie releases over vanity pressings considering what now constitutes "state of the art." The stigma is now the other way. A vanity pressing shows some guts. An indie pressing served by a label that hires an outside p.r. firm to put your shit together is intelligence-insulting, an affront. It shows your good at ass-kissing, networking and calling in introductory favors.
― George the Animal Steele, Thursday, 26 January 2006 20:30 (twenty years ago)
― pdf (Phil Freeman), Thursday, 26 January 2006 20:32 (twenty years ago)
― Brian O'Neill (NYCNative), Thursday, 26 January 2006 20:40 (twenty years ago)
― blackmail (blackmail.is.my.life), Thursday, 26 January 2006 20:41 (twenty years ago)
"Live at Leeds 71" is also excellent through and through. It's just very tightly played heavy rock noise with good improvisation by McPhee. It was also known as "Hoggin' the Stage," but the new version has an improved mastering job.
Those are two fine places to start. If you like either of them, then it's time to go to "Who Will Save the World?" and "Thank Christ for the Bomb."
==And now, before I forget, I should mention The Vacancies. They're on Blackheart Records and produced by Joan Jett and although it pains me to say this, why is she so interested in a very mediocre English-sounding stock punk rock band from Cleveland? Said to be good live although going to see a stock punk rock band in 2006 is like saying you'd like to catch a nose cold because you've forgotten momentarily what it felt like.
― George the Animal Steele, Thursday, 26 January 2006 20:42 (twenty years ago)
Actually, the rep is that xhuxk is well known for liking over the transom and unescorted stuff. It seems obvious to me that quite a few bands in NYC know it, judging by the bleedthru that gets sent to me in LA.
― George the Animal Steele, Thursday, 26 January 2006 20:44 (twenty years ago)
― Brian O'Neill (NYCNative), Thursday, 26 January 2006 20:49 (twenty years ago)
― xhuxk, Thursday, 26 January 2006 20:51 (twenty years ago)
You have to go back somewhat farther than that. Like when he lived in Michigan.
― George the Animal Steele, Thursday, 26 January 2006 20:52 (twenty years ago)
― xhuxk, Thursday, 26 January 2006 20:54 (twenty years ago)
― xhuxk, Thursday, 26 January 2006 20:58 (twenty years ago)
― George the Animal Steele, Thursday, 26 January 2006 20:59 (twenty years ago)
And oops, duh, Tesco IS Tesco Vee. The studio stuff was recorded at Touch & Go studios, produced by Corey Rusk, and obviously the Meatmen (who I've never listened to much) were on that label too. Which obviously explains why the reissue is on Touch & Go. Damn I'm slow.
― xhuxk, Thursday, 26 January 2006 21:04 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Thursday, 26 January 2006 21:11 (twenty years ago)
I always thought Nebula were pretty average, but I liked their last album okay (better than anything before), and as I recall the one before that had one (lead?) track that was an okay rip of "Train Kept a Rollin" or, um, some other train classic. Haven't heard the new one, though I gotta admit Mudhoney comparisons tend not to entice me.
― xhuxk, Thursday, 26 January 2006 21:15 (twenty years ago)
Broheems, You Do Need A Copy Of Black Diamond! A.K.A. The Groundhogs Thread
― scott seward (scott seward), Thursday, 26 January 2006 22:12 (twenty years ago)
Maybe because it's not 2005 anymore? Anyway, even if you change it to 2006, I do think the above statement is basically true, though I'm sure there are a few noise bands now who are better than Blight were. I just can't think of their names right this very second. (As for hardcore bands, I don't know when I last heard a good one of those.)
― xhuxk, Thursday, 26 January 2006 22:46 (twenty years ago)
There were a lot of noise bands that were better or equivalent to Blight, which was a kind of Tesco Vee joke which I seem to recall getting a line on from his 'zine. At least that was the impression. It didn't occur to me sooner, but the different Chainsaw 'zine reviewed a lot of them. We even had three cassette releases that were about 40 percent noise band acts. The most popular was called Annoy Your Neighbors With This Tape. Coincidentally, it did a lot to further the circulation of the Angry Samoan's right after the release of their Queer Pills EP and well before Back from Samoa became semi-popular. I still have an original copy.
I should make you a burn of Senseless Hate's Mechanical Death. Thurston Moore bought a copy and I swear when I heard Sonic Youth after their first LP and EP, he copied from the "tune," "We Destroy the Ants" on Mechanical Death, which was in an odd tuning and had that resonant character Sonic Youth was so fond of. There were Joisey noise bands, noise bands everywhere. Remember Mr. Epp & the Calculations? No? Well, from Seattle, it was another example.
I guess at some point I should compile some of this, particularly the Senseless Hate things that are tuneful. There's stuff like this laying about everywhere. It hurt more to make it then. Now it's accepted, even though it's still marginal. Shouldn't No Trend be part of this discussion?
― George the Animal Steele, Friday, 27 January 2006 07:10 (twenty years ago)
― George the Animal Steele, Friday, 27 January 2006 07:18 (twenty years ago)
Now playing the *Sonic Cathedral - Sirens* compilation ("an exclusive sampler celebrating the female voice in metal", by which they mean "dark gothic metal that often has no metal in it", which is fine with me), and I like a lot of it, especially the GREAT GREAT GREAT I FUCKING SWEAR HOW COME NOBODY LISTENS TO ANYTHING I SAY ABOUT THIS BAND Subterranean Masquerade, whose last CD had beautiful smooth jazz guitar parts and whose song "Suspended Animation Dreams" here is more blues psychedelia than goth metal. Other highlights include tracks by Peccatum, the Gathering, Star of Ash, Madder Mortem, and Lilitu. Also I just noticed that the song by Cirrah Nava, "Le Parade," starts with a weird Balkan organ-grider rhythm. Cool! So who the hell are they?
In other news, I never noticed until yesterday that the opening part of Rush's "Tom Saywer" blatantly ripped off the opening part of 10cc's "The Worst Band in the World," from like six years earlier. Is this common knowledge? Has it ever been documented before at all?
― xhuxk, Friday, 27 January 2006 14:34 (twenty years ago)
The Mastodon demos collection...sounds like just that. It's good, though. Will be more interested in the DVD.
― Ned Raggett (Ned), Friday, 27 January 2006 14:38 (twenty years ago)
― xhuxk, Friday, 27 January 2006 14:39 (twenty years ago)
― ng-unit, Friday, 27 January 2006 15:10 (twenty years ago)
― pdf (Phil Freeman), Friday, 27 January 2006 15:33 (twenty years ago)
― xhuxk, Friday, 27 January 2006 16:05 (twenty years ago)
― xhuxk, Friday, 27 January 2006 16:46 (twenty years ago)
Speaking of which, I had to review labelmates Green Carnation's new EP (came out Tuesday). I don't mind the tranquil nature or psychedelic undertones. I surely don't mind the complete lack of metal (they've had less metal every time anyway and it's supposed to be acoustic even though I'm pretty sure they plugged in and just played without distortion)... But the disc doesn't effect me on any level despite repeated plays. Is unexciting a word? Yeah, it is. And yeah, it is.
― Brian O'Neill (NYCNative), Friday, 27 January 2006 20:52 (twenty years ago)
― xhuxk, Friday, 27 January 2006 21:29 (twenty years ago)
― xhuxk, Friday, 27 January 2006 22:01 (twenty years ago)
― xhuxk, Friday, 27 January 2006 22:02 (twenty years ago)
I like the new Green Carnation album quite a bit. It's a rare instance where a metal band makes the transition to acoustic quite smoothly...acoustic records by metal acts are usually recipes for disaster, but like the last CD by Antimatter, this one is quite lovely. Accessible, yet deeply rooted in the prog that the band specializes in. It's all about restraint, and their ability to avoid too much theatrics (strings, percussion, etc.) is impressive.
(I do agree, though, The Quiet Offspring is better)
― a. begrand (a begrand), Friday, 27 January 2006 22:21 (twenty years ago)
― scott seward (scott seward), Friday, 27 January 2006 23:02 (twenty years ago)
― scott seward (scott seward), Friday, 27 January 2006 23:04 (twenty years ago)
Went down to Amoeba to sell some serious crap -- they wouldn't even consider taking The Sword or The Vacancies (!) -- but was able to come away with Sugrarcreek's box set. First time on CD, marked early 2005 or so from the band's vinyl pressings in the mid-80's.
On Beaver Records out of Charlotte, NC, it's right in there with M&R Rush's mix of bar band glammy AOR pop metal. Same clothes, the going bald dudes rockin' on the Jackie Stewart-style UK-country gentleman's cap initially patented by REO Speedwagon's first bass player, Greg Philbin.
The Virgin Encyclopedia of Heavy Rock (Larkin) proclaims Sugarcreek "top class pomp rock." First three albums get three and four stars. Fortune and Live at the Roxy, Charlotte, NC are the best. Since they earned their keep playing short point bars from Virginia Beach to Myrtle Beach, they had to be loud and rocking."Conquest for the Commoner" is even a mini-epic, being pop rockin' heavy prog, if such a thing can be imagined. Twisting Ed McMahon's Starsearch version of the Beatles' "Slowdown," too, before Zebra put it on a major label album.
― George the Animal Steele, Saturday, 28 January 2006 00:02 (twenty years ago)
Starcastle?
― scott seward (scott seward), Saturday, 28 January 2006 00:24 (twenty years ago)
― George the Animal Steele, Saturday, 28 January 2006 01:00 (twenty years ago)
Sugarcreek even do Queen and Lousianna Le Roux covers -- the former, a very good take on "Dragon Attack." The latter, can't tell, I no longer remember Le Roux that well. The guitars are chopping throughout which makes them heavier than the standard AOR. For the three CDs, no one ever said turn it down, now we have to have a radio friendly mix.
There had to be a Sugarcreek or M&R Rish in every US metropolis, one that offered hard rock show bars where the level of showmanship and professionalism was required to be high. With Sugarcreek, they made their own records and as with M&R Rush, had enough of a following that they never seemed very moved by the idea of a relentless pitch to a major label. Actually, the probably made more money regionally than a major could have ever done for them.
As per usual with the genre, Euros archive more enthusiasm for the original Sugarcreek vinyl and CD reissues.
And, xhuck, did you listen to Grouchy Rooster? I haven't yet, but it appears to be a subset of the people in Alligator Stew.
― George the Animal Steele, Saturday, 28 January 2006 17:41 (twenty years ago)
Ah, clarity. PDF's comment provides more and makes total sense. Hey, gots to build up the back catalog.
― Ned Raggett (Ned), Saturday, 28 January 2006 18:03 (twenty years ago)
This made me laugh:
Listen closely and you can hear the strain of a band struggling to sound as big as its aspirations. Listen even more closely and you can hear something else: the quiet sucking sound of a rock 'n' roll vacuum, waiting — still — to be filled.
A rock 'n' roll vacuum waiting to be filled. Savor that.
Now back to talking about all the hard rock 'n' roll regional recordings at CD Baby.
― George the Animal Steele, Saturday, 28 January 2006 18:19 (twenty years ago)
― ng-unit, Saturday, 28 January 2006 18:24 (twenty years ago)
― George the Animal Steele, Saturday, 28 January 2006 18:56 (twenty years ago)
"And, xhuck, did you listen to Grouchy Rooster? I haven't yet, but it appears to be a subset of the people in Alligator Stew."
― scott seward (scott seward), Saturday, 28 January 2006 19:04 (twenty years ago)
http://www.black-lotus-recs.com/mindex.html
― scott seward (scott seward), Saturday, 28 January 2006 19:24 (twenty years ago)
Anyone hear the new In Flames yet? It will be interesting to see how this one does with the new label and the fact that the Gothencore that they pioneered is now all Hot Topic-al.
I'm nto a huge fan of the band's later work, I'll concede, but I'll listen with an open ear when it comes in.
― Brian O'Neill (NYCNative), Saturday, 28 January 2006 19:34 (twenty years ago)
Got Leviathan's Howl Mockery At The Cross in the mail today, and Krisiun's new one, AssassiNation, yesterday. Also Chris Barnes's empty-headed new thing, Terror Killer - four jagoffs who started a Six Feet Under ripoff band and did their job so well they got the man himself to front them. Ya hoo.
― pdf (Phil Freeman), Saturday, 28 January 2006 19:52 (twenty years ago)
Obligatory MySpace Link:http://www.myspace.com/deadsea
"Salem" is a personal favorite however the band split it up on the MySyace page which renders it not as cool as the ten-plus-minute-epic that it is on the disc they self-released. Maybe it's a MySpace limitation... Still, a decent representation. And their live shows kill.
If anyone is interested in securing a copy of the disc, email me off the list and I shall forward the request to the band.
― Brian O'Neill (NYCNative), Saturday, 28 January 2006 19:56 (twenty years ago)
― Brian O'Neill (NYCNative), Saturday, 28 January 2006 20:00 (twenty years ago)
Maybe Deadsy will be defunct by the time Deadsea get signed. And do they want to get signed and why?
Which circuitously led me to Deadsy's Internet entry, of standard Wiki-aptitude for unintentionally comical distortion. You'd think they were popular instead of an unlistenable, neo-German general staff uniform-wearing offspring of celebrity charity-case signing.
http://en.wikipedia.org/wiki/Deadsy
― George the Animal Steele, Saturday, 28 January 2006 20:11 (twenty years ago)
It works so well, they should hire Lisa Miskovsky as their full-time lead singer.
― a. begrand (a begrand), Saturday, 28 January 2006 20:16 (twenty years ago)
I didn't even know Deadsy was still around...
― Brian O'Neill (NYCNative), Saturday, 28 January 2006 20:20 (twenty years ago)
― xhuxk, Saturday, 28 January 2006 20:20 (twenty years ago)
― Brian O'Neill (NYCNative), Saturday, 28 January 2006 20:26 (twenty years ago)
― George the Animal Steele, Saturday, 28 January 2006 20:26 (twenty years ago)
― xhuxk, Saturday, 28 January 2006 20:33 (twenty years ago)
I'm betting the lead singer was in his early-teens where his voice is/was still changing. Some of it is in a less "young-sounding" register. Lucifer's arrangements and song-writing, however, are definitely fully grown.
― George the Animal Steele, Saturday, 28 January 2006 20:40 (twenty years ago)
The new Cathedral definitely has moments that get just as wacky as Cold Lake...
― a. begrand (a begrand), Saturday, 28 January 2006 21:03 (twenty years ago)
Actually, it's a remastered version of their first nine-song demo...Lifesblood had only five of those tracks, while the other four were released on 7-inch singles. So yeah, while it's a money grab (can you blame Relapse?), it's a good compilation of early material for the fans.
― a. begrand (a begrand), Saturday, 28 January 2006 21:37 (twenty years ago)
― ng-unit, Sunday, 29 January 2006 04:30 (twenty years ago)
Sugarcreek continues to astound. "Lonely Blue" from the second disc of the box set is must hear glam rock. Many bands would kill for such a song in the armory.
― George the Animal Steele, Sunday, 29 January 2006 07:37 (twenty years ago)
― Brian O'Neill (NYCNative), Sunday, 29 January 2006 08:33 (twenty years ago)
― George the Animal Steele, Sunday, 29 January 2006 09:15 (twenty years ago)
>Electric Boogie Dawgs, *Sloppy Fast & Loud,* barbandboogiecowpunkbilly cdbaby.com band George mentioned somewehere above: I totally approve. Catchy, rocking, good sense of humor, not ugly. Pretty much what you'd hope a band with songs called *Rock and Roll Barbecue" and "Dead Toad Boogie" and "See Y'all in Hell" and "Rockasaurus" would sound like. (In the latter, the singer goes to a bar where the DJ is playing crappy techno music.)
-- xhuxk (xedd...), January 28th, 2006.
i'd say electric boogie dawgz (with a z, oopz) sound like a funkier and funnier and more kicking version of the first 12-inch jason and the scorchers EP (praxis OR major label version -- a compliment either way), but here's their own description from their cdbaby page, which I don't totally buy: "Imagine walking into a smoky, beer-soaked roadhouse with ZZ Top, Supersuckers and George Thorogood grinding out a relentless boogie groove together onstage. Meanwhile, David Lee Roth, Ted Nugent and Ween play poker in a corner booth while Slash and Chuck Berry shoot pool. You go to the bar to order a drink and the ghost of Waylon Jennings pours you a double bourbon ..."-- xhuxk (xedd...), January 28th, 2006.
I don't hear no Ween, Supersuckers or Slash in Electric Boogie Dawgz. They do an amusing number, however, that mocks guitar solos. As said, I liked the album way more than the Shack-Shakers' Pandelirium. It's more direct, gets down to rocking out without the baggage of goofball mythos the Shakers' now tote. Better sense of humor for the LP, less gimickry, none actually. Plus they'd like to be a red state hard rock bar band a roots rock band in altie-land at the 9:30 clubs.-- George the Animal Steele (70743.171...), January 28th, 2006.
actually turns out electric boogie dawgz dance a pretty decent heavy boogie, especially in the zz styled "chicken on the bone" and maybe the early flaming groovies (brownsville station?) styled "won't stop rockin." but mostly they have plenty of good jokes, like the title cut george mentioned, where they name a ton of guitarists they apparently respect (starting with stevie ray vaughan and angus young) and at least one they don't (eric clapton) and keep taking the same sloppy non-solo after every namedrop. and the one where they keep counting to nine but have the blues 'cause they can't make it to ten. a good solid silly swinging party CD. and if i had to choose, i'd still say they belong on the country thread more than the metal thread.-- xhuxk (xedd...), January 29th, 2006.
Brownsville and Cub Koda whether they know it or not. But only Teenage Head comes close to being as crunching while any style from the first five or so BS albums is in the same area. Standard but always astute observation in "Stone Cold Sober" that the object of assessment was more lively, intellectual and fun when a drunk, as opposed to a teetotaler. A band that could do justice to "The Martian Boogie."
"1-2-3-4-5-6-7-8-9" is also a fair Van Halen/DLR rip, only superior.
-- George the Animal Steele (70743.171...), January 29th, 2006.
― xhuxk, Sunday, 29 January 2006 18:00 (twenty years ago)
Pearls and Brass' The Indian Tower is rockly rocker's rock
The Indian Tower by P&B has arrived to take the Gold Medal in Non-Cheesy Hard Rock. Rarely, if ever, does a contemporary band come along that balances cock-rock with artistic experimentation this well.
[a graf or two snipped]
Now we must produce the provenance of the fossil.
"The band's authenticity makes me want to hear Mudhoney again."
=====That's it, let me up, I've had enough. Is it hard rock for people who don't like hard rock? It's being packaged like it.
From Nazareth, PA, where Earl Bud Hossler of the Kings used to live, so I know it well. Very nice town in a region largely devoid of them (visit Palmerton sometime, hoo-boy, and look at the purple-zinc-salt encrusted mountain, a superfund site denuded by New Jersey Zinc), home to the racing Andretti's and their speedway.
― George the Animal Steele, Sunday, 29 January 2006 20:06 (twenty years ago)
― xhuxk, Sunday, 29 January 2006 21:37 (twenty years ago)
>Is it hard rock for people who don't like hard rock? It's being packaged like it.
I know it is, but it's really just basic hard rock. Like I said upthread, it's poorly mixed (the bass and guitar are an indistinguishable roar, where they should have been separated like any 70s power trio would have done) and the drummer can't swing. I think their stealth religiosity (like what you were talking about w/r/t Trouble upthread) is becoming part of the marketing campaign, too - the NY Times' "metal for meditation" comment may have been a hint in that direction. P&B are gonna get labeled red-state savages transcending their Neanderthal-ness through amplification.
― pdf (Phil Freeman), Sunday, 29 January 2006 22:38 (twenty years ago)
― Zwan (miccio), Sunday, 29 January 2006 22:41 (twenty years ago)
― pdf (Phil Freeman), Sunday, 29 January 2006 22:51 (twenty years ago)
Arrghhh, I like red-state rockers better, though. I don't want things transcended for special intellectoisie rock critical dispensations.
I'm burning a copy of Grouchy Rooster's Real and Raw this afternoon. I thought it could be neat because it has songs called Southern Fried Snake, Louisiana Man and Poor Man Prayer on it.
Shit, at least half the stuff on this thread is either flat out red state or philosophically so. I mean Electric Boogie Dawgz are from California, but the only parts o California that are blue are LA, SF, Berkeley, Eureka and a couple other towns. The state goes blue because way more people live in those parts than the geographically more expansive red parts.
They're to Grand Funk what Will Oldham is to Johnny Cash, or something like that.
Urgh. In other words, one fault as Phil said = no funk in the Funk.
― George the Animal Steele, Sunday, 29 January 2006 22:52 (twenty years ago)
― Zwan (miccio), Monday, 30 January 2006 01:23 (twenty years ago)
― xhuxk, Monday, 30 January 2006 19:05 (twenty years ago)
** - *Engine Room* is only typed on a piece of paper insert inside the cardboard sleeve, not on the disc or the sleeve itself. weird!
― xhhuxk, Monday, 30 January 2006 19:31 (twenty years ago)
I know what you mean with the swing aspect though. They're looser live.
On the other hand, I don't get Early Man. I expected them to have a DFA remix track out already.
― blackmail (blackmail.is.my.life), Monday, 30 January 2006 19:46 (twenty years ago)
This morning I listened to Diecast for the first time in awhile. They capably massaged the part of my brain that needs generic metalcore to live.
― pdf (Phil Freeman), Monday, 30 January 2006 20:05 (twenty years ago)
― Ned Raggett (Ned), Monday, 30 January 2006 20:11 (twenty years ago)
Charles McNulty, who came from the Voice in 2005, reviewed it.
"Still you've got to hand it to a decade that considered guys with painted-on jeans, heavily appliqued belts and fried Farrah Fawcett butch."
"So when the conveniently named Sherrie Christian leaves Kansas to make it big in Hollywood, her parents belt out Night Ranger's 'Sister Christian.'And after she convinces her cute co-worker, Drew, at the 'Rock of Ages' club on Sunset to go for his dream, he hammers out Twisted Sister's 'I Wanna Rock.' Needless to say, when life reaches a crisis point for our heroine, she'll be serenaded with a rendition of Steve Perry's 'Oh Sherrie.'"
"...When Lonnie falls in love with the last person you'd expect [this must be a crypto-gay reference], the two break out into REO Speedwagon's 'Can't Fight This Feeling'..."
"For those whose skin is starting to crawl right now, be warned that you might find it hard to resist the infectious head bobbing which reached epidemic proportions in the audience during Whitesnake's 'Here I Go Again' and Quarterflash's 'Harden My Heart.'"
Another CD Baby special, Shotgunn's We Go Way Back. Not southern, not Sunset strip, but trio stuff on their own label, which is where the best material I've been listening to has come from in the first quarter in my quarters. 2006 rule: If it's an indie and has a press agent -- inhouse or outhouse, it's for the toilet.
Consider, you're on an indie, the label serves the record through it's p.r. contractor, like the Departments of Defense or Homeland Security shilling something or someone they want want written about to Federal Computer Week. The Federal Computer Weeks all line up to write that which is peddled by the peddlers because it's on a schedule, it's product and it's the way of things.
Anyway, you're the band -- and you get the press in the Federal Computer Weeks of indie music, and you're granted a booker who puts you on a thirteen date whirlwind tour of the US. You get to every town but two -- one on the east coast and one on the west coast, both with over 4 million people living in them, and there are no copies of your CD in stores and no more than twenty people at the gig if it's not a Thursday-Friday-Saturday and Thursday is pushing. (The example that breaks the rule: Occasionally there will be one copy of your CD in town, but no one will know which store it is in.)
Wow, wasn't that fun. Now you're ready to be in a musical or a parody where people with money will actually pay to see you perform other people's music!
― George the Animal Steele, Monday, 30 January 2006 20:47 (twenty years ago)
Trio -- heavy don't step on the grass sam heavy bar band rock from Denver. Take your time, break the rules, have a woozie party or something like it on "Give In."
Heavy white rhythm & blooz on "Heart Attack" -- mumbling but tuneful vocals by someone who wishes the object of desire, she, was older. Is he smacking his chops for jailbait? "This is serious," he sings. Then there's a chopping solo with a bit of the snake thrown in, working off the rhythm, which is in the pocket.
"We Go Way Back" more white boy blooz shouting, only the guy's not quite a shouter. Doesn't matter, the rhythm section supports it with hard rock shuffling, funky strides and monkey beats. Tricone national or country dobro or tinny metallic acoustic used to back up the electric riff, a technique you'd think would be used more often because it sounds neat.
First three songs, three solid crunchers.
"Drunk Babies," next tune, falls flat because the singer tries to sound sensitive, which makes him come off like the dude in the Black Crowes doing his Gram Parsons thing. "Drunk babies burning hisself," yurgh.
With that out of the system, "Bad Night Bar Blues" goes back to the good stuff. More chopping grooving white boy rhythm & blooz.
"Fine Wine" -- here comes brother Chris and the Black Crowes' southern home companion almanac again. Found Jim Dickinson or Jai Winding or somebody to play electric piano. This is where they light up the cyalume sticks in the audience except this band never plays in places where the kids can buy 'em.
Two more songs, both fair to good. Band writes about what it knows, a mix of crunching hard rock, heartland midwest stuff, the riff on the last tune, "Hey Kids" is trad and kills. Not enough cowbell. That's a compliment.
― George the Animal Steele, Monday, 30 January 2006 22:17 (twenty years ago)
― xhuxk, Tuesday, 31 January 2006 15:10 (twenty years ago)
― George the Animal Steele, Tuesday, 31 January 2006 16:41 (twenty years ago)
From:
http://www.geocities.com/Athens/Parthenon/2669/Lucifer.html
"LUCIFER and Church of Satan member David Powers wins first prize at talent show for 'Hump Day' celebration during Mediterranean Deployment. As representative of the Legions of Darkness, Powers performed mostly LUCIFER material for nearly a half an hour (plugged and unplugged) to the ecstatic crew.
Powers currently serves in the United States Navy on board a Guided Missile Destroyer in the Harry S. Truman Carrier Battle Group."
OBD's Minister of Musick & Knight of The Infernal Empire, Mr. Powers is also currently composing music for the next LUCIFER unleashing.
The Order of The Black Dragon congratulates Mr. Powers in this accomplishment, and we look forward to his safe and victorious return. Hail United Satanic America! HAIL SATAN. ====And I think we can all agree that "Crush the Enemy" is a good song to play if you're in the US military.
― George the Animal Steele, Tuesday, 31 January 2006 20:18 (twenty years ago)
So success in this manner of music does come down to a sheer lottery. Practically speaking, anyone can win. It's all a matter of astounding good luck. Networking, connections, bribes, quid pro quos and calling in favors help a bit to get the ball rolling.
The entire series of Leslie and Corky's home tapes of Mountain playing at various venues just went on-line. Arghhh -- MississippiQueenNantucketSleighrideMissippiQueenCrossroaderMississippiQueen.
― George the Animal Steele, Wednesday, 1 February 2006 18:10 (twenty years ago)
http://www.opinionjournal.com/la/?id=110007902
― baby, disco is fuck (yournullfame), Thursday, 2 February 2006 04:42 (twenty years ago)
Alas, the Cookie Monster school of death metal is dying
Sorry, more kids listen to Slipknot, System of a Down, and Melissa Cross bands than watch PBS.
― Ian Christe (Ian Christe), Thursday, 2 February 2006 07:28 (twenty years ago)
lots of cookiemonster around though, he just ain't looking
― rizzx, Thursday, 2 February 2006 08:25 (twenty years ago)
― a. begrand (a begrand), Thursday, 2 February 2006 08:42 (twenty years ago)
― Brian O'Neill (NYCNative), Thursday, 2 February 2006 08:53 (twenty years ago)
― Monte Conner's Secret Weapon, Thursday, 2 February 2006 12:56 (twenty years ago)
It's a bug story, something put together with simplicity and baby talk about biting insects/weird animals/poisonous plants/fatal diseases to vaguely entertain the WSJ's readership, which mostly would never buy Scum or have heard of it.
Lots of newspapers do 'em. It's called "look at the queer stuff I found today." Interviewing Frank Oz would be a coup if Stuttering John or Ali G had done it. Y'know, some operation with an obvious sense of humor. Since the WSJ has no funnybone, it's just laborious busy work.From the editorto the reporter: "I think we need a sentence from the Muppets guy. Can you call him to get his side of the story?"
What the heck did anyone expect the guy to say? "Yes, they pay me a good royalty and it's an artistic peak of which I am most proud."
Next week: Classic rock [or any type of fill-in-the-blank rock] is dieing. The kids prefer computer games and running websites devoted to the exchange and sale of backyard wrestling home DVDs.
― George the Animal Steele, Thursday, 2 February 2006 16:35 (twenty years ago)
― George the Animal Steele, Thursday, 2 February 2006 16:37 (twenty years ago)
>I finally figured out that Copperhead's probably-catchiest and most rousing song "Keepin' On" basically IS "Keep On Rollin'" by REO Speedwagon -- same hook and everything, and no that is not an insult. Also, "Stricken" on their album turns into "Black Betty" by Ram Jam for a couple seconds, and they cover "Drift Away" (better than Uncle Kracker) which somehow I never noticed before but which makes perfect sense given their soul-country side project Southwind, and "Free Man" has a cool acid-rock organ break and like all great free-man songs reminds me of South Side Commission's great early gay disco classic "Free Man," though usually when hard rock bands sing about being a free man I think they're singing about getting out of prison whereas when gay disco bands sing about it they're more likely singing about the entire prison of LIFE. Unless I am completely wrong.
― xhuxk, Thursday, 2 February 2006 16:45 (twenty years ago)
― pdf (Phil Freeman), Thursday, 2 February 2006 16:46 (twenty years ago)
― Brian O'Neill (NYCNative), Thursday, 2 February 2006 17:30 (twenty years ago)
― pdf (Phil Freeman), Thursday, 2 February 2006 17:45 (twenty years ago)
The Radio 1 - Rock Show, http://www.bbc.co.uk/radio1/rockshow/
has a Norwegian Black Metal music special. [Now on Listen Again - 2 Hours]
We meet the legends of Norwegian black metal in Part 2 of our Scandinavian special.
Includes interviews with Emperor, Darkthrone, Dimmu Borgir and 1349.
― DJ Martian (djmartian), Thursday, 2 February 2006 18:09 (twenty years ago)
After living with the album for a while, I've found the album's first half is a touch on the pedestrian side, but then really takes off on the last four tracks, when they start singing about iron swans, extinct cows, and whatnot.
― a. begrand (a begrand), Thursday, 2 February 2006 18:40 (twenty years ago)
Metal Blade Records will release a deluxe box set by the acclaimed '80s Atlanta thrashers HALLOWS EVE, entitled "History of Terror", on March 10. This box set includes all three of the group's Metal Blade albums (all remastered!), piles of bonus material and a bonus DVD (with a playing time of 200-plus minutes!). Liner notes will be included as well.
"History of Terror" track listing:
Disc 1:
"Tales Of Terror" (remastered)
01. Plunging To Megadeath02. Outer Limits03. Horrorshow04. The Mansion05. There Are No Rules06. Valley Of The Dolls07. Metal Merchants08. Hallows Eve (including Routine)
"Death & Insanity" (remastered)
09. Death And Insanity10. Goblet Of Gore11. Lethal Tendencies12. Obituary13. Plea Of The Aged14. Suicide15. D.I.E.16. Attack Of The Iguana17. Nefarious18. Nobody Lives Forever19. Death And Insanity (Reprise)
Rehearsals June 1984
20. The Mansion21. Metal Prisoners (WARRIOR)
Total: 75:29 min
Disc 2:
"Monument" (remastered)
01. Speed Freak02. Sheer Heart Attack (QUEEN)03. Rot Gut04. Monument05. Pain Killer06. The Mighty Decibel07. The Righteous Ones08. No Sanctuary
Rehearsals May 1984
09. Scream In The Night (EXCITER)10. There Are No Rules11. Eighteen (ALICE COOPER)12. Hallows Eve
1st Demo "Tales Of Terror"
13. Hallows Eve14. Metal Merchants
Live 8/17/85 The Montreal Palladium, Canada
15. Nefarious16. Horrorshow
Total: 77:48 min
Disc 3:
Live 9/22/85 CBGBs, NY (Soundboard Recording)
01. Plunging To Megadeath02. Valley Of The Dolls03. Suicide04. Attack Of The Iguana05. Lethal Tendencies06. Evil Offerings (prev. unreleased)07. The Mansion08. Metal Merchants09. Hallows Eve
LIVE 11/24/85 Essex, MD
10. Plea Of The Aged11. Horrorshow
Live 11/27/85 CBGBs, NY
12. Evil Offerings (prev. unreleased)13. The Mansion14. Metal Merchants15. Hallows Eve
Live 12/18/86 Swizzles in York, PA
16. Goblet Of Gore17. Nefarious18. Death And Insanity19. D.I.E.
Total: 78:25 min
Disc 4 (DVD):
Live 12/5/86 (?? -87- ??) Poughkeepsee, NY
01. Pain Killer02. No Sanctuary03. Goblet Of Gore04. Rot Gut05. Monument06. D.I.E.07. Speed Freak08. Drum Solo – Rob Clayton09. The Mighty Decibel10. Death And Insanity11. Valley Of The Dolls12. Metal Merchants13. Sheer Heart Attack (QUEEN)14. Riff Raff (AC/DC) – CUT
Live 12/12/86 Middletown, NY
15. Intro: Obituary16. Goblet Of Gore17. Valley Of The Dolls18. Suicide19. Plunging To Megadeath20. Horrorshow21. D.I.E.22. Attack Of The Iguana23. Death And Insanity24. Lethal Tendencies25. Plea Of The Aged26. Metal Merchants27. Hallows Eve
Live 12/18/86 York, PA
28. Goblet Of Gore29. Nefarious30. Valley Of The Dolls31. Suicide32. D.I.E.33. Attack Of The Iguana34. Death And Insanity35. Lethal Tendencies36. Plunging To Megadeath37. Metal Merchants38. Hallows Eve39. Encore: Evil Offerings (prev. unreleased)
Live 11/18/86 New York, NY
40. Goblet Of Gore41. Nefarious42. Valley Of The Dolls43. Suicide44. Death And Insanity45. Lethal Tendencies46. Plunging To Megadeath47. D.I.E.48. Metal Merchants49. Hallows Eve
Total: 206:44 min
(DVD 9) PAL / Region Code: 0
― pdf (Phil Freeman), Thursday, 2 February 2006 18:48 (twenty years ago)
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Thursday, 2 February 2006 18:56 (twenty years ago)
Not hearing that. If it did, I'd have liked it more, a lot more. WG had a sense of humor of which there is none obviously coming off the Sword. Death Penalty also wasn't recorded like a stoner rock album with stereophonic monolithic sound. Plus, you didn't get the armchair D&D thing. As for the last four tunes, I never get that far. I might have once. Maybe I ought to try again or just plain start there.
Or I could go back to Cargun which has been enjoyable on almost all cuts. Tonight might also go to Regenesis, but that's over on the prog thread.
― George the Animal Steele, Thursday, 2 February 2006 18:59 (twenty years ago)
The riff from "Lethal Tendencies" is still in my head and it has to have been at least ten years since I last threw it on.
"Out of foooooooooooooood, out of time..."
― Brian O'Neill (NYCNative), Thursday, 2 February 2006 19:22 (twenty years ago)
― pdf (Phil Freeman), Thursday, 2 February 2006 19:45 (twenty years ago)
Title track: Aborym - Generatorhttp://www.myspace.com/aborym666
This Aborym track is impressive powerful black metal, 1 minute 15 seconds into the track sounds like vintage Emperor, then the big looping progressive rock spacey sections of guitar work ala Enslaved - circa 2 minutes into the track are sublime, so majestic.
― DJ Martian (djmartian), Thursday, 2 February 2006 19:53 (twenty years ago)
hey, george, or whoever, have you ever heard Seven Witches? With Jack Frost on guitar? Crash Music sent me two reissues of theirs. One is from 1999 and i can't remember when the other one is from. Anyway, really cool NWOBHM priest/maiden mayhem. highly entertaining.
― scott seward (scott seward), Thursday, 2 February 2006 22:56 (twenty years ago)
new relapse ecard for forthcoming: unearthly trancehttp://www.relapse.com/ecards/unearthlytrance/
unearthly trance - the trident
due april 4th
― DJ Martian (djmartian), Thursday, 2 February 2006 23:24 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 3 February 2006 00:35 (twenty years ago)
― scott seward (scott seward), Friday, 3 February 2006 00:40 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 3 February 2006 00:42 (twenty years ago)
Heh...same here. Some great Metal Blade stuff on there, Fates Warning, Slayer, etc.
― a. begrand (a begrand), Friday, 3 February 2006 00:54 (twenty years ago)
― pdf (Phil Freeman), Friday, 3 February 2006 02:00 (twenty years ago)
The 1994 reissue came today. It's on Rock Candy, is pushed by a couple Brit metal critics, was never in CD land previous. Jack Douglas-produced band that was formerly the LA Jets with Karen Lawrence. The LP took off on the second side into amazing woman blooz singer fronting band doing stoked Aerosmith and Led Zeppelin-styled heavy rock. The closer, "Anastasia," is volcanic even down to the imitation balalaika. Another prime cut is "Radio Zone." Lawrence wrote a song made into a hit by Barbra Streisand, but couldn't collect on it because as a youthful member of the LA Jets, had signed away her publishing in exchange for a record deal.
She also sang backup for Aerosmith and is now in a reasonably well known blooz band in California. Comes with some extra live cuts -- raw and fuzzy from cassette, showing she could sound incredible, like an air raid siren on some tunes.
And the Gooz, my old pal from the Highway Kings, went to see Early Man at the Khyber Pass in Philly last night. Toted a full band and two Orange stacks and rocked, says he, finishing with "Death Is the Answer." A good time was had by all. He even liked The Sword muchly -- on the undercard and whom I still can't abide.
― George the Animal Steele, Friday, 3 February 2006 02:59 (twenty years ago)
Played In Flames's new one yesterday, and it also seemed listenable but undistinctive. They're still melodic enough, I guess; what most struck me about the album so far is how *sceamo* its vocals sound. Usually that would totally turn me off; here I don't mind, really, but I can't say it especially grabs me either. I think I found them more interesting when they had more Thin Lizzy guitar interplay or were doing industrial version of '80s Genesis hits. Jeanne, are the screamo vocals what you mean by "very apparent just how much hardcore has 'borrowed' from metal in recent years"? As someone who has no idea what bands are supposed to be "hardcore" now or why, since much of metal and hardcore have basically been mixing up genes for the past quarter century and have basically been exactly the same thing for most of that time, I'm not sure I get your point, to be honest!
― xhuxk, Friday, 3 February 2006 14:41 (twenty years ago)
― Je4nne Æ’urÂ¥ (Je4nne Fury), Friday, 3 February 2006 16:42 (twenty years ago)
― blackmail (blackmail.is.my.life), Friday, 3 February 2006 16:52 (twenty years ago)
I think my definition of hardcore is warped because a lot of the NYHC bands that I associate as "hardcore" were more of a punk hybrid than a metal hybrid. I haven't been exposed to many older bands who were mixing metal and hardcore until the past 10 or so years except maybe Black Flag and Cro-Mags (who I don't think are that good to begin with and therefor never really bothered with), maybe even later.
― Je4nne Æ’urÂ¥ (Je4nne Fury), Friday, 3 February 2006 17:00 (twenty years ago)
xp - Most all of the NYCH stuff - Cro-Mags, Agnostic Front - was metallic. Which was funny because the bands got crap for getting *too* "metal" on subsequent albums. AF actually derisively called Victim In Pain their "metal" abum relatively recently. Although the Cro-Mags got more crap on album #1 which was their *prog* album.
― Brian O'Neill (NYCNative), Friday, 3 February 2006 17:18 (twenty years ago)
NOSCE TEIPSUM/ZERO DEGREES FREEDOM *Split CD* from Australia via cdbaby.com -- I like the Gregorian/Carol Orff/whatever spooky gothic bombast fanfare they start out with and that slips back in now and then, hate the gratutiously ugly and unlistenable on purpose death-by-vomiting vocals by both bands throughout. Others might like this more.
― xhuxk, Friday, 3 February 2006 17:31 (twenty years ago)
― xhuxk, Friday, 3 February 2006 17:34 (twenty years ago)
Okay, I will take a deep breath....
(sorry, Jeanne, no offense to you! This has always just been a pet peeve of mine, sorry.)
― xhuxk, Friday, 3 February 2006 17:38 (twenty years ago)
― scott seward (scott seward), Friday, 3 February 2006 17:39 (twenty years ago)
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Friday, 3 February 2006 17:43 (twenty years ago)
― scott seward (scott seward), Friday, 3 February 2006 17:49 (twenty years ago)
So yeah, xhuxk, metal and hardcore (and metal and just about everything else) was mixed up before the New York scene, but when you compare the music of their *contemporaries* in other regions, the New York stuff had a lot more metallic bombast than other scenes.
I mean, I loved Minor Threat (and still do) but even as a kid I knew that there was a huge sonic difference between them and AF/Cro-Mags even though I lovged that stuff too.
Not for nothing, the first time I ever saw Sick Of It All, they were opening for Exodus. It was an odd bill. Blood, Sweat No Tears hadn't come out yet and all the metalheads were hanging in the back. I was up front with a couple of baldies. The band was quite surprised that one of the long-hairs in attendance knew them from the track on the Revelation comp "New York Hardcore: The Way It Is". And this wasn't *that* early for such things (or so I thought).
(Oh, in my post above, Warzone got crap for going "prong" with album #3, not 1.)
― Brian O'Neill (NYCNative), Friday, 3 February 2006 17:53 (twenty years ago)
Prong got crap for a lot of things though... ;)
― Brian O'Neill (NYCNative), Friday, 3 February 2006 17:55 (twenty years ago)
― scott seward (scott seward), Friday, 3 February 2006 18:00 (twenty years ago)
― xhuxk, Friday, 3 February 2006 18:02 (twenty years ago)
― scott seward (scott seward), Friday, 3 February 2006 18:04 (twenty years ago)
― xhuxk, Friday, 3 February 2006 18:07 (twenty years ago)
― scott seward (scott seward), Friday, 3 February 2006 18:13 (twenty years ago)
― xhuxk, Friday, 3 February 2006 18:17 (twenty years ago)
Actually, the music of that scene was a lot more varied than I give it credit - it's just that the stuff I latched onto at the time was the meathead mook-core stuff. At the same time you also has (as was mentioned before) Gorilla Biscuits and No Redeeming Social Value. You also had Murphy's Law who were interesting. I remember them for their embrace of ska and the like but maybe that was later?
xp - Yeah, Crumbsuckers were from NY.
xxp - I liked Leeway too! I especially liked their album that everyone hated Desperate Measures because it was so damn catchy. Maybe that's why people hated it... Their loss.
― Brian O'Neill (NYCNative), Friday, 3 February 2006 18:17 (twenty years ago)
Ludichrist begat Scatterbrain and Crumbsuckers begat Pro-Pain.
― Brian O'Neill (NYCNative), Friday, 3 February 2006 18:18 (twenty years ago)
― xhuxk, Friday, 3 February 2006 18:23 (twenty years ago)
Proletariat is on-line now. I had all that stuff and they weren't very hardcore, more Euro and mid-tempo. Big swathes of guitar, rigid beats, attention-getting.
Murphy's Law were a really stupid band that played in the Lehigh Valley at the Airport Music Hall regularly with Mucky Pup, who were equally dumb. Lost of people fighting. Fighting in front of the stage, fighting in the parking lot and after a few minutes there would always be a couple of squad cars to take the worst of them off to jail. ML's Jimmy Gestapo would be drinking beer piped into his mouth from a big funnel and hose. By the end of the set he'd be so anesthaetized, he'd leap into the air, stretch out his legs and come down flat on his back. I bet he has serious ruptured disc and laminar problems now.
Since the newspaper features section covered these shows I saw just about everyone. They were beyond wretched.
― George the Animal Steele, Friday, 3 February 2006 18:40 (twenty years ago)
NYHC affiliated bands I liked: Cro-Mags, Judge, Breakdown, Gorilla Biscuits, Sick Of It All (actually saw all of these except Breakdown on the same bill one time at City Gardens in Trenton). I still have Cro-Mags and Judge in my iPod as I type this, and if I ever remember to buy the CD with Breakdown's demo tape on it (they never had an official release) I'll probably blast that for a week straight, too. Never liked Bold or Youth of Today or Warzone (who I saw open for the Ramones at the Ritz on 54th Street in 1989 or so).
― pdf (Phil Freeman), Friday, 3 February 2006 19:02 (twenty years ago)
― xhuxk, Friday, 3 February 2006 19:12 (twenty years ago)
xhuxk, it's a show on A&E that inspired the "punching and kicking rollerderby girls" reference with regards to Hank III. White trash-ville redneck goyls do humiliating rollerderby which is about no rules fighting and hair-pulling, thinking they're going to be big pro sport stars instead of the publicity desparate trailer park tintypes they will always be. Catfights, vulgarity, people being ruthless and mean to each other for the sake of entertainment.
― George the Animal Steele, Friday, 3 February 2006 19:26 (twenty years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Friday, 3 February 2006 19:56 (twenty years ago)
i liked all the east coast straightedge shit, and i was in danbury for it, which was sort of ground zero for the CT factions. but i liked the metal stuff from new york (everything already mentioned) AND all the peacepunk stuff like false prophets, a.p.p.l.e., etc.
okay, fine, i liked everything.
― scott seward (scott seward), Friday, 3 February 2006 20:05 (twenty years ago)
I'm amazed how far you guys got into an 80s metal vs. hardcore hybrid without mentioning Suicidal Tendencies or SOD. From where I sat, ST's first record (1983) was the Tigres-Euphrates of hc/metal hybridization (listen to the guitar solos!). There was no going back after that djinn was out of the bottle.
Although NYC was late to that party, they put it over the top - SOD completely joined metal and hardcore at the hip (the music as well as the audience). 3/4 of Anthrax playing hardcore will do that I guess.
By the time Suicidal Tendencies released their second album in '87 "crossover" was in full swing - "going metal" was a career move. Agnostic Front, DRI, Gang Green, Fear, Murphy's Law, hell, even I Against I reflected the change. Man, did I hate all that shit. Sorry, Scott.
― Edward III (edward iii), Friday, 3 February 2006 21:44 (twenty years ago)
One gig that didn't make the Music Hall was DRI/Sick Of It All, or maybe the second act was Biohazard, I forget. It had been scheduled for one of A-town's "upscale" rock clubs and at the very last minute the owner got cold feet and unilaterally cancelled, afraid the place would be trashed. It was immediately rescheduled for a dive. The bands arrived, the show went off, and the place was trashed. The ceiling, being low, was torn down. Pictures ran in the newspaper's weekend edition.
Just got back from Pasadena Tower were I declined to part with any cash money. Did see the current issue of Revolver on the stand. It caught my eye because of the goods promised inside. "Girl on Girl Antics" and "Naughty Interviews" with the sexiest women in metal. Of course, none of it was true although a good photographer took the full page pictures. Scott's ol' pal Liz Buckingham was there.
I remember Revolver being touted on rockcritics.com at one point, a magazine where the editor or editors insisted only the finest quality music writing was accepted and if you spelled one name wrong and the copy editor caught it, ya were dismissed. To which comes to mind, again, the high brow intellectoisie of "Girl on Girl Antics" and "Naughty Interviews."
Did get a chance to listen to Morningwood. Originally had asked on teenpop but it might as well go here, too. Did one song, "Easy" that kind of sounded like bad AC/DC. Loud guitars on a good number of songs. They did a lot of different things, none memorably. Not good. Not awful, just ehh.
'm amazed how far you guys got into an 80s metal vs. hardcore hybrid without mentioning Suicidal Tendencies
Hey, I'll mention it. More beloved cannon fodder for fighting gigs in the Lehigh Valley. Always supremely reliable for someone getting hurt, cop cars, girls being beaten up, trash fires -- like urban blight. A totally worthless sociopathic act with a surprisingly large Valley audience of completely contemptible, at least for one night, dolts.
― George the Animal Steele, Friday, 3 February 2006 21:51 (twenty years ago)
― scott seward (scott seward), Friday, 3 February 2006 22:08 (twenty years ago)
Ha, I told Xhuxk it was a bad Paybacks song. Still, it's my favorite on the album by far.
I was definitely late(r) to the NYHC party, mostly because of my age and the fact that I got into the scene by default -- a younger brother. But I always thought it was so f*cking cool how there would be a handful of mega-tough chicks beating the shit out of everyone in the pit. For such a mook genre of music, there were *always* chicks representing.
Speaking of Murphy's Law, they opened for Andrew WK at his last show in NYC at Irving Plaza.
― Je4nne Æ’urÂ¥ (Je4nne Fury), Friday, 3 February 2006 22:11 (twenty years ago)
And Morningwood's "Easy" was the stand out for me. If the entire album had stuck to that vein a bit more I would have been tempted.
― George the Animal Steele, Friday, 3 February 2006 22:57 (twenty years ago)
is this where we talk about kinghorse?
― baby, disco is fuck (yournullfame), Friday, 3 February 2006 23:59 (twenty years ago)
I re-purchased Suicidal Tendencies' How Will I Laugh Tomorrow When I Can't Even Smile Today, Controlled By Hatred/Feel Like Shit...Deja Vu and Lights...Camera...Revolution a month or so ago. They hold up well.
― pdf (Phil Freeman), Saturday, 4 February 2006 15:10 (twenty years ago)
what did y'all think of this review?
― rizzx (Rizz), Saturday, 4 February 2006 16:52 (twenty years ago)
Here's a teaser:
And they are quick to cut to the heart of the matter, offering chilling new angles on the Drei-Reiche-Lehre concept, sweeping up gristle and blood from History’s meat market, and considering Charlemagne’s Holy Roman Empire, Hegel, Sade, and logocentrism
i really don't like this metal thread, at all :(
Then don't read it. We'll still have a merry time.
Back to regular transmission: The next one could also be on thudrock or rolling prog threads, Nektar's we're-back-together in 2004 live CD is over two hours of their show. Contains most of Remember the Future, Recycled and A Tab In the Ocean plus a lot of stuff I don't remember. Albrighton's guitar is up front and as metal prog, they wrote chugging riffs punctuated with bursts of acid-fried lead. Startling how good it is for -- oh, no [!] -- old people. Possibly satisfying to the lovers of space rock, hard rock, math/prog all at the same time, although I've always prefered the simplicity of prog over math.
― George the Animal Steele, Saturday, 4 February 2006 17:06 (twenty years ago)
it was too long for me to read, but i dig it! Very goth. my review of that album was way goth too:
http://www.decibelmagazine.com/reviews/nov2005/deathspell_omega.aspx
― scott seward (scott seward), Saturday, 4 February 2006 17:16 (twenty years ago)
― George the Animal Steele, Saturday, 4 February 2006 17:30 (twenty years ago)
― scott seward (scott seward), Saturday, 4 February 2006 17:32 (twenty years ago)
― scott seward (scott seward), Saturday, 4 February 2006 17:39 (twenty years ago)
Okay, see you in 2007...
― Ian Christe (Ian Christe), Saturday, 4 February 2006 18:09 (twenty years ago)
― George the Animal Steele, Saturday, 4 February 2006 18:35 (twenty years ago)
Yeah, I was right to skip grad school.
― xhuxk, Saturday, 4 February 2006 19:21 (twenty years ago)
a) when i wanna read about metal, i head for stylus.
b) stewart voegtlin (who also writes highfalutin' reviews for dusted) needs to lay the metal on the floor and back away slowly.
― baby, disco is fuck (yournullfame), Saturday, 4 February 2006 21:16 (twenty years ago)
― George the Animal Steele, Saturday, 4 February 2006 22:39 (twenty years ago)
― scott seward (scott seward), Saturday, 4 February 2006 22:47 (twenty years ago)
― Thomas Tallis (Tommy), Saturday, 4 February 2006 23:01 (twenty years ago)
i really like this album, but this guy voegtlin -- who someone else mentioned also brings the post-structuralism over at dusted.com -- he just ... words fail me. i have never come across someone who can so completely take a dump in print all over my enjoyment of music I otherwise adore. he ruins without equal. obvs i should just stop reading him, but it's like a bruise I can't help but touch.
― pm (p-m), Sunday, 5 February 2006 00:14 (twenty years ago)
― rizzx (Rizz), Sunday, 5 February 2006 00:34 (twenty years ago)
Or possibly overcompensation for getting beaten up by the Prussians too many times.
― George the Animal Steele, Sunday, 5 February 2006 03:54 (twenty years ago)
― xhuxk, Sunday, 5 February 2006 05:07 (twenty years ago)
― George the Animal Steele, Sunday, 5 February 2006 06:30 (twenty years ago)
The Black Angels, *Passover*. Also indie guys with borderline metal credentials, but I like them a lot more. From Texas, five guys. Clear Velvet Underground (not VU's second album) influence, filtered near as I can tell through early Dream Syndicate, first Echo and the Bunnymen album, maybe debut EPs by Flaming Lips or Raveonettes or somebody. But louder than that seems; they've got a girl credited with "drone machine," even. Their own debut EP came out last year, and so far as I can tell two of the album's better songs ("Black Grease" and "First Vietnamese War") led it off. "Call to Arms" is a good nine-minute closer with a lovely raveup guitar climax; a couple minutes after it ends, there's a hidden track about letters from people fighting in Iraq, more singer songwrterly than the rest of the album, which is bearable until the ending where the guy keeps saying "stop the war" over and over and I kept saying "stop the song." Album's listenable all the way through, though in this case like many similar cases it may well turn out that the EP is still the one to keep.
― xhuxk, Sunday, 5 February 2006 16:39 (twenty years ago)
..partially because most people probably don't *remember* (if they ever knew in the first place) how loud dream syndicate or flaming lips could be early on. but also i mean that the vietnamese war song REALLY reminds me of something off the first and best echo and the bunnymen album *crocodiles,* but rocks louder than echo and the bunnymen ever did.
― xhuxk, Sunday, 5 February 2006 17:18 (twenty years ago)
― scott seward (scott seward), Sunday, 5 February 2006 17:31 (twenty years ago)
But yeah, Red Swan are great. Which reminds me I just saw Ted Nugent on TV, working in a Michigan hunting store in some pre-Superbowl skit, and he shot some guy who came in with his crossbow. There was a stupid laugh track, but it was still nice to see him on TV.
― xhuxk, Sunday, 5 February 2006 22:19 (twenty years ago)
― scott seward (scott seward), Sunday, 5 February 2006 22:24 (twenty years ago)
― scott seward (scott seward), Sunday, 5 February 2006 22:26 (twenty years ago)
Ted's usually witty but if I watch to much of him and his wife going on about their wholesome family, their wholesome American dream, soldier and the holy sanctity of hunting and grilling your own food, I get a headache. It never seems to occur to Ted that some people, not necessarily leftists, Commies and anti-America types, have bad memories associated with riflery and the military.
― George the Animal Steele, Sunday, 5 February 2006 22:39 (twenty years ago)
backup vocals in this track remind of the jesus and mary chain (which is probably what i meant by "raveonettes" too, come to think of it.) so throw them into the equation as well.
― xhuxk, Sunday, 5 February 2006 23:23 (twenty years ago)
Who knew death metal could be this vital and impressive in the age of deathcore?
― George the Animal Steele, Monday, 6 February 2006 00:22 (twenty years ago)
― pdf (Phil Freeman), Monday, 6 February 2006 02:05 (twenty years ago)
― George the Animal Steele, Monday, 6 February 2006 02:51 (twenty years ago)
"Deutsch"! Really?
Big Business: bass and drums ruled that High on Fire gig I went to last Thursday! Thx Decibel!
― blackmail (blackmail.is.my.life), Monday, 6 February 2006 03:40 (twenty years ago)
I'm going to put this on thud or prog or something, but the digital copy of the first album by Audience from '69 is pretty cool, very rocking, weird-ass pop and hard-sounding for a band with a bass player, a saxaphone on half the tunes, and a singer/guitarist who played a nylon-stringed instrument.
― George the Animal Steele, Monday, 6 February 2006 05:29 (twenty years ago)
Wasn't that LaMonte Young / John Cale's pre-VU marathon drone ensemble?
― Edward III (edward iii), Monday, 6 February 2006 15:43 (twenty years ago)
george, you should check out the seven witches stuff. same guitarist (jack frost) as the bronx casket company albums.
― scott seward (scott seward), Monday, 6 February 2006 19:25 (twenty years ago)
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Monday, 6 February 2006 19:44 (twenty years ago)
― blackmail (blackmail.is.my.life), Monday, 6 February 2006 20:49 (twenty years ago)
― xhuxk, Monday, 6 February 2006 22:28 (twenty years ago)
― pdf (Phil Freeman), Monday, 6 February 2006 22:52 (twenty years ago)
― xhuxk, Tuesday, 7 February 2006 02:41 (twenty years ago)
A song on Audience's first album was said to be the basis for "Stairway to Heaven," Howard Werth claiming Jimmy Page took it after his band opened for LZ in a club date that earned them a contract. Werth also takes credit for Dylan's "Knockin' On Heaven's Door." For the former, re Page and "Stairway," I'm not hearing it. But Audience is one of those totally weird but still pop song writing acts that would have been inspiration to a lot of Brit peculiars, and by extension, US peculiar hard rock. Like Skafish and Cheap Trick. The delver owes it to himself to look into Audience.
― George the Animal Steele, Tuesday, 7 February 2006 03:02 (twenty years ago)
― xhuxk, Tuesday, 7 February 2006 15:40 (twenty years ago)
― George the Animal Steele, Tuesday, 7 February 2006 16:46 (twenty years ago)
El Tri were originally (until they cleaned up their act, a la Eric Clapton post-Cream) called Three Souls in My Mind, who were a great, fucked-up Mexican psych band that sang about Drugs and Satan.
They also sang the INTREPIDOS PUNKS theme song.
― Ian Christe (Ian Christe), Tuesday, 7 February 2006 19:00 (twenty years ago)
Is this the one they're pushing with the DVD at Tower Records. If so, I didn't see that song in the list of titles. Or something else? In any case, the 2 CD set is also in stock.
― George the Animal Steele, Tuesday, 7 February 2006 20:42 (twenty years ago)
― xhuxk, Tuesday, 7 February 2006 21:46 (twenty years ago)
― ng-unit, Tuesday, 7 February 2006 21:55 (twenty years ago)
― George the Animal Steele, Tuesday, 7 February 2006 21:55 (twenty years ago)
Opinions differ. It's one of the Federal Computer Weeks of music journalism. If you haven't ever read or heard of FCW, you'll be blank, but if you do know what it is, the analogy is apt. FCW is devoted to the process, people and bureaucracy of federal agencies, the Department of Defense, it's multitudes of operations and the corportions and people that do business with them. It's mind-numblingly full of jargon and infrastructure as journalism. It appears complicated and full of information, but it's information of almost zero value. It is as dull as dishwater and devoid of any obvious sense of humor.
If Federal Computer Week had a sense of humor, like most music pubs that follow its way of journalism, it would be one that its fans thinks is acidic and clever but which appears to everyone else on the outside as long ream of toilet jokes.
It's natural that music mags, including metal ones, would duplicate Federal Computer Week-style journalism. The reviewing and interviewing of the microgenres is all about process and promotional schedules, and the production of laudatory copy that is convincing to absolutely no one except those profiled in it. Drink your own Kool-Aid or being a believer in propaganda is a requisite, if only for time you don the hat of particpator in it.
Jargon, styles and classifications of bureaucracies and bureaucrats were codified by Federal Computer Week. The metal 'zines and a lot of other similar music magazines have extended the same techniques and tools to covering their respective beats.
Federal Computer Week is a magazine for a club. The club is corporate information officers, government IT workers, apparatchiks and all the conventions and seminar they go to as well as the speakers and vendors at the same cons. Wholesale, it's been duplicated by the music trades. Metal 'zines are a club. Every time I've picked one up for the last fifteen years I've been always been entertained by the multiplication of microgenres and eagerness to coin new jargons. The astonishingly many and grandiose reviews of CDs that move more promotional copies than they actually sell is like reading profiles in FCW of the CIOs and assorted of vice-presidents of Pentagon Machinery, Inc. or the corporate descriptions of new businesses offering something for government contracts.
If you don't know the club or the rules or the rigid tenets of metal microstyles, then anything outside that "is just not metal." As a process invented by Federal Computer Week it was if you don't know the terminology for the latest in productivenetworkwares, or the current hot fad in efficiency auditing and tigerteaming, you're on the outside.
Hey, when someone shows up and whines "I really don't like this metal thread" then we know our job is done.
As to the new indie rock. Hmmm, who needs a new indie rock? It's like saying we need a new strain of flu. What's good about obscure signed bands represented by the same run-on-automatic booking agencies and p.r. agencies?
― George the Animal Steele, Tuesday, 7 February 2006 22:24 (twenty years ago)
― scott seward (scott seward), Tuesday, 7 February 2006 22:37 (twenty years ago)
http://www.thesatanicinquisition.cjb.net/
― scott seward (scott seward), Tuesday, 7 February 2006 22:55 (twenty years ago)
"This is a cutting-edge publication like none other. Since both editors are incarcerated, scene, show and album reviews are strongly desired. While interviews with musicians and interesting persons are also of interest, passionate writing about nearly any subject will be considered — especially with a Satanic-slant. Complete manuscripts as well as queries are fine. If you have clips of previous work, they are welcome, but not required. What is more important is a strong cover letter or query explaining why you are qualified or suited to write the piece or pieces. Payment comes in the form of a by-line, courtesy copies and Satanic salutations. E-mail queries and manuscripts to: lord_morder@yahoo.com"
― scott seward (scott seward), Tuesday, 7 February 2006 22:56 (twenty years ago)
* - my Voice review of which (along w/ other '01 metal EPs) is here:
http://www.villagevoice.com/music/0113,eddy,23384,22.html
― xhuxk, Wednesday, 8 February 2006 14:04 (twenty years ago)
― xhuxk, Wednesday, 8 February 2006 14:09 (twenty years ago)
― xhuxk, Wednesday, 8 February 2006 15:54 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 8 February 2006 15:55 (twenty years ago)
"10 songs into 99 tracks"
this is an anti-filesharing thing they do on promos now. surprised you never noticed it before.
― scott seward (scott seward), Wednesday, 8 February 2006 15:57 (twenty years ago)
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Wednesday, 8 February 2006 16:03 (twenty years ago)
i've noticed it before, scott! (mainly on dropkick murphys CDs, for some reason.) but it's still *rare* on promos. and it's still stupid.
so phil and scott, what do you like about akercocke? i don't get it.
― xhuxk, Wednesday, 8 February 2006 16:09 (twenty years ago)
My reasoning is that if you don't take a stand, you just get pushed around by p.r. types and the labels more. One good idea is to devote the review to the anti-copy protection scheme instead of the music, mentioning the act only in passing. You should do that with Ackercocke, xhuxk, in one of your one-liners. "Extreme metal band that hit trash because of copy protection," or "Copy protection not cost effective in promotion," or "Band killed by dumb label tracking trick -- steal their music, anyway, on principle."
It's another example of Federal Computer Week-ism. Fifteen years ago, FCW and pubs like it would sometimes review software. Some of the companies were so nuts over software pirates they come up with a scheme called the "dongle" to stop it. You'd get a copy of the software along with a little gadget that you had to screw onto one your PC's outside ports. If it wasn't there, when the software fired up, it would quit, thereby supposedly detering you from copying it to a BBS where other people could steal it.
You heard it here first: Eventually, a really stupid record company will try to float this idea again, distributing a dongle-like (buy it once, and you're finished [!] they will proclaim] thing to screw onto an out on your stereo, your PC and anything else you wish to play their music on.
― George the Animal Steele, Wednesday, 8 February 2006 16:28 (twenty years ago)
As far as what I actually like about Akercocke, I like that their black metal is intricate, with the same kind of faux-Middle Eastern prog breaks Led Zeppelin occasionally wallowed in, and long songs which make a half-hour train ride from home to work more enjoyable. Not for home listening, but excellent while blasted through headphones en route to someplace that promises to be disappointing. And I like the guy's vocals. And their suits.
― pdf (Phil Freeman), Wednesday, 8 February 2006 16:43 (twenty years ago)
Often the band isn't worth the copy protection if you sit down and do a tough-minded evaluation of their audience and sales potential. Copy protecting a band that, at best, could only hope to sell a few hundred to three or four thousand copies is pointless. It's like protecting a bag of dirt. It certainly doesn't help the act as they'll never see any significant royalties past whatever paltry advance they were granted.
― George the Animal Steele, Wednesday, 8 February 2006 16:55 (twenty years ago)
I like the ambition of the Ackercocke album. Or what ILM's Siegbran would call the "half-assed experimentalism" of the Ackercocke album. And I like their metal soundz as well. I think I might prefer the new Solefald album though. as far as art projects go.
― scott seward (scott seward), Wednesday, 8 February 2006 16:59 (twenty years ago)
My promo of the new Decapitated is like that. The publicist promised me a finished copy, though, so I have to e-mail him today (it came out yesterday) and bug him about that.
― pdf (Phil Freeman), Wednesday, 8 February 2006 17:14 (twenty years ago)
― scott seward (scott seward), Wednesday, 8 February 2006 17:32 (twenty years ago)
I don't care anymore, since I'm usually playing the CD on a computer anyway. Pointing and clicking at track 38 in iTunes is no biggie.
Plus 99-track Dillinger Escape Plan and Morbid Angel CDs on shuffle are AWESOME.
― Ian Christe (Ian Christe), Wednesday, 8 February 2006 20:39 (twenty years ago)
The new Ephel Duath is actually improved quite a bit by playing it this way.
― pdf (Phil Freeman), Wednesday, 8 February 2006 20:42 (twenty years ago)
When stuck with lemons make lemonade.
"Checks & Balances," US Secret Service ready, catchy in the way of Elton Motello's first record.
http://myspace.com/jaikwillis
― George the Animal Steele, Wednesday, 8 February 2006 20:59 (twenty years ago)
― xhuxk, Wednesday, 8 February 2006 22:07 (twenty years ago)
― xhuxk, Wednesday, 8 February 2006 22:39 (twenty years ago)
― xhuxk, Wednesday, 8 February 2006 23:17 (twenty years ago)
― xhuxk, Wednesday, 8 February 2006 23:33 (twenty years ago)
I friggin' hate those CDs. The recent Gamma Ray album had the fadeouts. Next time that happens, do a Decibel review where every 20 words, it's either cut off by blank space, or is interupted by, "YOU ARE READING A REVIEW OF..."
I don't mind the 99 track dealies as much, though my un-labeled 99 track version of last year's Leng T'che album was so confusing, I couldn't review the album at all.
On a side note, I heard some stuff from the new album by The Gathering today, and it sounds pretty great.
― a. begrand (a begrand), Thursday, 9 February 2006 02:25 (twenty years ago)
Or just download the record like everybody else. It's practically your journalistic duty, unless you'd rather be in Iraq chasing bombs.
― Ian Christe (Ian Christe), Thursday, 9 February 2006 02:49 (twenty years ago)
Earache seems to be the main metal proponents of this type of copy-protection. Century Media/Nuclear Blast still use cardboard-sleeve promos. Candlelight sends me burned discs in little black sleeves. Both methods disuade from promo-selling (we don't even try and sell anything not in normal packaging; do they have resale value in any retailers in your areas?)
I put up no less than 30 new CDs into the "New Metal Arrivals" wall the past two days. Some are actually new while some are just new to me (imports and the like). Let's see what I can recall from my home computer...
* In Flames* Mastodon old shit compilation* Dimmu Borgir re-recording (the import vinyl has a 7" single in it)* Burst* Edguy (import digi)* Behemoth (limited edition EP)* Candlemass (the first of the reissues - I need these big time)* Thyrfing (with a couple of reissues)* A bunch of Black Lotus stuff (Greek label mentioned above)* A bunch of Galy stuff (Canadian label rarely mentioned)* Eyes Of Fire* Insense & Satariel (both Candlelight)* Century (Tribunal Records)* Satyricon reissues* Hammerhead (NWOBHM retrospective; I would like to hear this one)* Charon (Spinefarm)* Neuropathia (album cleverly entitled Satan Is a Cunt)
There are a few DVDs too... A couple of splits - one with Birdflesh and someone else, another with Sabbat (Japan) and Desaster, another with Regurgitate and Suppository... Even more I can't think of. No doubt something that'll piss me off I forgot.
We have a big in-store on Saturday - In Flames dropping by. If anyone is in Columbus, drop by. 5:00.
― Brian O'Neill (NYCNative), Thursday, 9 February 2006 04:46 (twenty years ago)
― xhuxk, Thursday, 9 February 2006 14:32 (twenty years ago)
Relapse -- a lot of it although there often seems to be no rhyme or reason to what will be copy-protected and what isn't. I spent a review of Dillinger's last one beating them over the head for it. After that, not all of them came copy-protected. The Leng T'che was one that did and it made the decision, after listening to it once and actually liking it, to toss it in the trash. The Journey DVD was a spectacular ly annoying example of it. The p.r. company then had the nerve to ask me if I was going to cover it after sending the damned thing.
My position's well known on this after the Sony debacle. I might not be so aggressively down on it if I didn't no computer and data security so intimately. If you don't draw the line with corporations fiddling with various protocols and make them see their is a cost to it, they simply go ahead with their wretched plans and demean the experience for everyone.
It's well known that a lot of people will become accustomed to being put upon and inconvenienced by paranoid or stupid technology and consequently brush it off as no big deal. Epitaph's Dropkick Murphy's was also, as mentioned, a 99-cuts-of-death promo. It contributed to the band getting a poor review, except for one song. Listening to it with the aim of evaluation was an exercise in arithmetic and put me in a bad mood everytime.
The copy protection schemes simply make no sense for the myriad bands on the metal labels that specialize in the margins. They don't sell enough. While there may be people who make them available on slsk or some other file-sharing network, you'll never convince me there's much lost. And of the few that copy the newest CDs to their computers obsessively, the accumulation of stuff is what they are after. It's an "audience" -- a really small one -- that would never buy the CDs in stores anyway, no matter how successful your copy protection. You can't squeeze money out of that demographic no matter how hard you try.
they have resale value in any retailers in your areas?)
At Amoeba, no. This is contributed to by the phenom that LA is a town where there's a good collection of people receiving promos. And by observation, you can deduce that they all bring in their new releases in for redemption as soon as they arrive. Or at least within the week.
― George the Animal Steele, Thursday, 9 February 2006 17:07 (twenty years ago)
― George the Animal Steele, Thursday, 9 February 2006 18:08 (twenty years ago)
* Decapitated* Vital Remains (remastered debut)* Gates Of Slumber (Excellent Indiana doom)
― Brian O'Neill (NYCNative), Thursday, 9 February 2006 18:14 (twenty years ago)
Storage? Storage?!! Geez Xhuxk, you're really a Volz guy, aren't you? Some of the Schlitt stuff, like "All Fired Up" and "Get On Your Knees and Fight Like a Man", is really good in a poppy Van Hagar sort of way (which I suppose means Volz=Roth, which is weird). But yeah, your pix are good, except I never dug "Shakin'" and "GGRARTY" that much.
Petra>>>>>>>>>>>>>>>>>>>>>>>>>>>Test Icicles, yes?
― dr. phil (josh langhoff), Thursday, 9 February 2006 18:39 (twenty years ago)
― xhuxk, Thursday, 9 February 2006 19:18 (twenty years ago)
― xhuxk, Thursday, 9 February 2006 19:24 (twenty years ago)
The LA Times, of course, Phoned It In for it's Grammy coverage. Way too much ink, a special section. Robert Hilburn as his most phoned-in handwringing and sincere on the injustice of Kanye West only winning three awards. He was shut out of the what he deserved! The injustice and implied calumny of it! The Grammy voters ignored the best album of the year, the one Pazz & Jop made king of the hill!!!!! And we're all -- make that me -- yes, I'm sick of the all the woman singers who sound the same, their lips quivering as they look to the sky, their throats warbling out their facsimiles of overwraught tremolos and vibratos. (Mary Blige, the Edge should have bashed you over the head with his guitar.) The paper lamented Gretchen Wilson not winning. An unexpectedly excellent development because the redneck shtick, the midgets in bars video, the spitting chaw into a cup, was all wore out and nauseating months ago. But McCartney's guitarists did a good job with the descending riffage of "Helter Skelter."
However, buried inside was a freelance piece on the Les Paul tribute in town, which was sparsely intended and dominated, make that ruined, by the heavy metal and hard rock types who think they have something to do with Les only because they play a guitar with his name on it.
Some good excerpt, not PHONED IN:
"It's hard to imagine what the organizers were thinking in choosing [Stephen Seagal] -- an aspiring blues musician who has suddenly developed a southern accent -- to open the show with former Muddy Waters guitarist Hubert Sullivan...At least he mumbled his way through actual songs..."
"The rest of the night was mostly a spectacle of screaming fretboard pyrotechnics, courtesy of Toto's Steve Lukather who drained the nuance out of Jimi Hendrix's 'Little Wing' ... and Joe Satriani, who got the award for loudest and longest solo without melody." Actually, the Satriani show is amusing because Joe -- one of the most annoying men in rock and roll -- quite obviously almost never uses a Les Paul. It would get in the way of his endorsements for whatever -other- guitar he shows up holding in the guitar mags.
This next one is choice, Suicidal Tendencies at a Les Paul tribute...
"Punk band ST were also called in at the last minute and somebody decided it would be a good idea to invite along Christian power-rockers Switchfoot. It wasn't.
― George the Animal Steele, Thursday, 9 February 2006 20:36 (twenty years ago)
― George the Animal Steele, Thursday, 9 February 2006 20:38 (twenty years ago)
Magrudergrind/Shitstorm grindcrud EP does not appear to be a vanity release, though I've never of its record label (Robotic Empire in Richmond, Virginia) before. Has anybody else?
― xhuxk, Thursday, 9 February 2006 20:51 (twenty years ago)
― Brian O'Neill (NYCNative), Thursday, 9 February 2006 20:55 (twenty years ago)
― scott seward (scott seward), Thursday, 9 February 2006 20:55 (twenty years ago)
― scott seward (scott seward), Thursday, 9 February 2006 20:56 (twenty years ago)
― scott seward (scott seward), Thursday, 9 February 2006 20:57 (twenty years ago)
(Much of the Citay CD thing is instrumental, which is better than when the guy sings. Who knows, maybe guitar players would be less bored with it than I am. Maybe they'd be less bored with Fucking Champs, too.) (Actually, I have two guitarist friends who *like* that band, come to think of it. To me they just seem completely cold, clinical, and pointless.)
― xhuxk, Thursday, 9 February 2006 20:58 (twenty years ago)
― xhuxk, Thursday, 9 February 2006 20:59 (twenty years ago)
― scott seward (scott seward), Thursday, 9 February 2006 21:01 (twenty years ago)
Journalistically, I've never seen anyone explore it.
― George the Animal Steele, Thursday, 9 February 2006 21:31 (twenty years ago)
― scott seward (scott seward), Thursday, 9 February 2006 21:46 (twenty years ago)
You'll never convince me that slsk and its user ilk are lost sales. They're the standard pirate demographic. They would never buy the stuff even if file-sharing of these CDs didn't exist. They'd be stealing something else.
I'm sure it is frustrating. The guy from Bona Fide records, which has just started up again after quitting during the end of the age of vinyl, how hard it is just to get distributed.
But the explanation doesn't take into account a lot of factors. One of the bigger ones is glut. There simply isn't enough talent to justify the many records which are made. It's a limit of the human condition.
Now everyone wants to make a record. And maybe they should be encouraged to make records or have the opportunity to do one, or at least botch it up, even more than once. But I don't get the reason for an entire infrastructure of label, booker, pr parasite, trade magazine that has grown up around it.
The answer isn't to make more records on the backs of people who would be better off doing everything themselves. Indeed, even if you really suck, there's more nobility and honor to it. There's little that says worthless more loudly than an unlistenable act in any microgenre, on someone else's label, with a p.r. firm servicing their goods to the journalists.
Now the T-shirt deal makes sense to me because I've seen it in action. The Angry Samoans' Mike Saunders has made his California show merch table into an astonishing operation that brings in a substantial amount of money at each show. More T-shirts sell than CDs -- which he also prices exceedingly low -- five to seven dollars, usually five, and at that cost, they move. But the clothing is the real engine.
Now for bands that don't command any guarantee -- and the Samoans do command a significant one -- the merch table is a good opportunity. But even then it comes with thorns. If you want to make money and move quantity, you'll want to play venues where the club doesn't take a cut of the gross sales, so you can price economically. The Samoans don't do gigs where the clubs take a piece of the action. But not everyone has the clout to do that, can afford to do it, or are always given the option of doing it.
So the label can make money on T-shirts. Good, I'm buying that. And the implication is that many or some acts sell a lot more T-shirts than they will ever sell records. So why even make the record? Just make the T-shirt and play live.
You can make the record on your own dime. You can even make on demand CDs through a number of outlets. You can buy them at slightly above cost of manufacture for sale at shows as needed. Or your fans, IF YOU HAVE ANY INCLINED TO BUY A CD, can buy them and they are burned on demand. This, too, is complicated, in that the Federal Computer Weeks of music journalism don't like to review on-demand CDs -- that is CD-R burns -- if a more "professional" product isn't promised at some point, or at least convincingly look like it's guaranteed. And that's a laughable distinction but that's my perception.
So from that standpoint, I guess at a label you have to go the trouble of actually having your CDs stamped so as to at least get in the door of having promo copies potentially reviewed. Then everyone can review them, and still they won't sell enough to make a product profitable. Which tells you, there's too much product, among many other things.
Don't get me wrong. I have a lot of sympathy for the small business trying to survive on making new music. But using merchandise to underwrite it, while it may work, sure looks like it's only putting off the inevitable.
― George the Animal Steele, Thursday, 9 February 2006 22:24 (twenty years ago)
Circle Of Dead Children gets my endorsement too.
― Brian O'Neill (NYCNative), Thursday, 9 February 2006 23:58 (twenty years ago)
yeah, but as someone who writes for a publication you've labeled thusly (dB), this simply isn't true. in fact, the bulk of what i've reviewed has been cd-rs in an unmarked sleeve with no expectation whatsoever of packaging.
not everything fits beneath your Federal Computer Week's analogy you've trotted out this week.
― blackmail (blackmail.is.my.life), Friday, 10 February 2006 00:21 (twenty years ago)
I get CD-R burns. The last Fireball Ministry was a Radio Shack disc in a white paper sleeve. And which of these is a strictly homemade job? I didn't check them all individually. Hey, why do the promotional materials I get for material of this nature generally always include some fine print on who is doing radio, who is the distributor, who is doing everything to assure you it's a professional product, not something else inferior.
Albums Burst Akercocke August Burns Red Biolich Bleeding Through Cathedral Cripple Bastards Dark Funeral Deadboy and the Elephantmen Divine Empire East West Blast Test Fireball Ministry
I know your offended by the urban slum metal 'zine/Federal Computer Week thing. Heck, the people at FCW would be offended. I apologize and if you think it sounds personal, it's not. It's one observation of trade 'pub phenomena.
― George the Animal Steele, Friday, 10 February 2006 00:38 (twenty years ago)
― George the Animal Steele, Friday, 10 February 2006 06:31 (twenty years ago)
I'm not personally offended by it really - I understand your frustration with popular magazines and their publishing imperatives. I'm just pointing out that we're not all beholden to those imperatives as contributors.
More importantly, am I alone in my appreciation for Thyrfing's latest?
― blackmail (blackmail.is.my.life), Friday, 10 February 2006 14:35 (twenty years ago)
― George the Animal Steele, Friday, 10 February 2006 17:36 (twenty years ago)
Big in Boston, right? At ritual beatdowns and crucifixions of NYC HC. Dropkicks couldn't exist without 'em. Battling Mick Punk with a big F for Fighting. Now why couldn't this have won a Grammy for cover art/design instead of Aimee Mann's phony thing about with the boxer's arm?
Perfect music for putting on while watching "The Chiefs" on Pay-Per-View. You know, that documentary that makes the characters in "Slapshot" look like graduates of a Dale Carnegie seminar on how to make friends.
― George the Animal Steele, Friday, 10 February 2006 18:14 (twenty years ago)
This is as OI as it gets. I'm surprised more people are not all over this. It's so bad it's really good. I'm serious. I could be delirious over the first song so my judgment might be warping more than usual.
― George the Animal Steele, Friday, 10 February 2006 18:26 (twenty years ago)
― George the Animal Steele, Friday, 10 February 2006 18:55 (twenty years ago)
"Music: Agression, Alice In Chains, Amebix, Annihilation Time, Babyland, Berlioz, Bjork, Black Sabbath, Blu Aus Nord, The Chameleons, Charles Mingus, Chopin, Cinematic Orchestra, Cocteau Twins, The Cure, Cynic, Dead Can Dance, Dead Kennedy's, Deep Puddle Dynamics, Del Mar, Dismember, Disrupt, DJ Shadow, Don Caballero, Dysrhythmia, Echo and the Bunnymen, Entombed, Explosions In the Sky, From Ashes Rise, Godflesh, Gorguts, High On Fire, His Hero Is Gone, Jesu, John Coltrane, Lisa Gerrard, Mahavishnu Orchestra, Massive Attack, Mastodon, Meshuggah, Miles Davis, Ministry, Mr. Bungle, Mum, Municipal Waste, Nasum, Neurosis, Pendereki, Portishead, Primus, Red Sparrows, Rotten Sound, Rudimentary Peni, Skinny Puppy, Slayer, Sleep, Sonic Youth, Squarepusher, The Swans, Tchaikovsky, Terrorfakt, Terry Bozzio, Thomas Hakke, Trance To The Sun, T.S.O.L, UK Decay, Virgin Prunes, Xploding PlastiX"
Except for Mr.Bungle, I am with him all the way!
― scott seward (scott seward), Friday, 10 February 2006 18:59 (twenty years ago)
― George the Animal Steele, Friday, 10 February 2006 19:16 (twenty years ago)
― George the Animal Steele, Friday, 10 February 2006 19:45 (twenty years ago)
― George the Animal Steele, Friday, 10 February 2006 19:47 (twenty years ago)
― xhuxk, Friday, 10 February 2006 19:54 (twenty years ago)
― xhuxk, Friday, 10 February 2006 20:01 (twenty years ago)
Choke really does sound like Dick Manitoba on all the Dictator/Wild Kingdom Manitoba-typical tunes like "I Am Right." Good for Choke, not so good for the Dictators.
― George the Animal Steele, Friday, 10 February 2006 20:26 (twenty years ago)
― George the Animal Steele, Friday, 10 February 2006 20:32 (twenty years ago)
― latebloomer (latebloomer), Friday, 10 February 2006 20:35 (twenty years ago)
Has anyone mentioned the Ark album yet? They're opening for the Darkness's Euro tour.
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Friday, 10 February 2006 21:26 (twenty years ago)
― xhuxk, Friday, 10 February 2006 21:43 (twenty years ago)
I just got this today...man, those voiceovers burn me. Especially when an album sounds as great at this one does!
When the real album surfaces on Oink, I'll just burn that, and toss this promo in the trash.
― a. begrand (a begrand), Friday, 10 February 2006 22:52 (twenty years ago)
― a. begrand (a begrand), Friday, 10 February 2006 22:54 (twenty years ago)
And in this afternoon's most You've Got to Be Kidding Me moment: A promo copy of Richard Butler's solo album. "Singing softly and having the vocals out front felt very daring to me...'
Choke, bash this guy in the teeth with your hockey stick.
― George the Animal Steele, Friday, 10 February 2006 22:57 (twenty years ago)
Now, amazingly, I've had an opp to listen to The Darkness. The markof Roy Thomas Baker is strong upon it. They or someone must've dragged him out of retirement with the promise that he could go to town. Anyway, I'm still with the conviction they've waited too long but the title cut and "Knockers" right off the bat give the label things to work. The title cut is slightly better -- it has a wonderful chorus hook -- and a sitar break in it not played by a sitar, but probably by a Variax guitar. It's a guitar with a computer in it that emulates vintage instruments, and it works, and it has sitar algorithms in it...===
Anyway, it sounds real Asian and it goes where the guitar solo usually goes on a good song, so it really gives the thing an air. I suppose it could actually be an old Coral Sitar gee-tar, which sounds the same, but you really don't even need 'em anymore.
― George the Animal Steele, Friday, 10 February 2006 23:09 (twenty years ago)
Sky High doesn't really sound anything like what I reviewed for a couple years ago. It might be a different band. Then they were in the stoner club but no longer. That's good, it shows progress, or the realization that if you're a stoner band you've chosen to live in a landfill, so to speak.
Sky High has a nice mainstream hard rock production which makes the guitars sound terrific. I like that. And the title track, while not catchy (and I think it's supposed to be catchy), is exciting. But Bad Wizard singing is ... they just shouldn't sing. They should chant or declaim or shout emphatically. That means the songs that are supposed to be songs with a singer aren't that great. But the tunes that are hot jams and comps that bite down on one riff are pretty good. "Pass It On," which closes the album and is the longest tune is like that. The band really chomps on it. And "Black Navigator," a mood piece, is fine, too.
Now that guy Choke in Slapshot, there's a vocalist.
― George the Animal Steele, Saturday, 11 February 2006 16:27 (twenty years ago)
Though I don't know either band very well, I am wondering if saying the Test Icicles aren't as good as the Blood Brothers conforms to your Pink Guitar Principle?! Test Icicles photos:
http://blog.verbosecoma.com/archives/test%20icicles.jpghttp://www.rockfeedback.com/images/testicicles_bandwatch.jpg
Which band is more fun? (I don't know the answer to this; I am just WONDERING.)
― Tim Ellison (Tim Ellison), Saturday, 11 February 2006 22:28 (twenty years ago)
>Derail, *Engine Room,**:...* - *Engine Room* is only typed on a piece of paper insert inside the cardboard sleeve, not on the disc or the sleeve itself. weird!<
Actually, it IS on the [cardboard] sleeve. It is just on the back, upside down.
― xhuxk, Sunday, 12 February 2006 00:59 (twenty years ago)
Ah, you're right; my apologies.
― Tim Ellison (Tim Ellison), Sunday, 12 February 2006 01:35 (twenty years ago)
About half is ear-splitting in a bad way. The other half is ear-splitting in a good way. "Pesante," title cut, is one of the few with a vocal, and has the guy growling how "pesante" is his "musica" or something like that over a good rhythm machine beat. "Dark Angel Libido" is the longest track and the best along with the title cut. Probably good for a rave. Brutal and very frequently clumsy acid-fried guitar, often piercing feedback, with the neat concussive sounds that a six-string can make always coming in and out of the background. "La cucaracha" theme -- you know, the quote people get their car horns to play only this is on guitar, is a recurring motif on "Libido." (I'm not ruling out it's coincidental.) The guy indicates his love for Hendrix but doesn't even sound remotely close. Funny title of song not worth hearing, "I'm Not Satriani" and, indeed, Metaliano isn't.
Bats about .500 and it's definitely art instro metal noise but not the kind most like to say they're going nuts over. I'm not nuts over it but it's good for repeat listens.
― George the Animal Steele, Sunday, 12 February 2006 18:22 (twenty years ago)
So what's the deal, xhuxk mentioned this was a shuck band upstream, right?
― George the Animal Steele, Sunday, 12 February 2006 20:35 (twenty years ago)
greatdayforup has good momentum--rocking in general in fact--foiled by a shitty singer. makes me think of corrosion of conformity, superjoint ritual, clutch, i forget who else. put nebula and greatdayforup on the CD changer with ten years after's latest and the live album by hypstryrz from late last year, and nebula and greatdayforup were left in the dust.
― xhuxk, Monday, 13 February 2006 03:20 (twenty years ago)
― George the Animal Steele, Monday, 13 February 2006 06:10 (twenty years ago)
― Brian O'Neill (NYCNative), Monday, 13 February 2006 22:47 (twenty years ago)
http://www.citypages.com/databank/27/1314/article14109.asp
― George the Animal Steele, Tuesday, 14 February 2006 00:02 (twenty years ago)
― George the Animal Steele, Tuesday, 14 February 2006 16:31 (twenty years ago)
downsized...
― blackmail (blackmail.is.my.life), Tuesday, 14 February 2006 18:40 (twenty years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Tuesday, 14 February 2006 19:43 (twenty years ago)
― pdf (Phil Freeman), Tuesday, 14 February 2006 20:44 (twenty years ago)
― George the Animal Steele, Tuesday, 14 February 2006 21:05 (twenty years ago)
― xhuxk, Tuesday, 14 February 2006 21:12 (twenty years ago)
― xhuxk, Tuesday, 14 February 2006 21:13 (twenty years ago)
― George the Animal Steele, Tuesday, 14 February 2006 21:20 (twenty years ago)
* - who are superwolf? i am getting all 496 wolf bands mixed up now.
― xhuxk, Tuesday, 14 February 2006 22:22 (twenty years ago)
― blackmail (blackmail.is.my.life), Tuesday, 14 February 2006 22:43 (twenty years ago)
Leaning toward my favorite Watts Passage songs being "The Legend of Shifflet Hollow" (which sounds like Oneida when they used to rock and concerns the people of Shenandoah forests, apparently; "life beyond the gravel road, you get the feeling that you've been here before") and the epic five-and-a-half-minute "Blind" (where the vocals most do the high-pitched glam-slimey Axl thing.) The title track is just a fat chant hooked to some Naked Raygun woagh woagh woaghs. Entire CD has only eight songs, lasts less than half an hour. A smart length.
― xhuxk, Tuesday, 14 February 2006 22:58 (twenty years ago)
it's horrifying if there's a knockoff, even though i kinda liked that album more than anything oldham had done recently.
― blackmail (blackmail.is.my.life), Tuesday, 14 February 2006 23:20 (twenty years ago)
― xhuxk, Tuesday, 14 February 2006 23:35 (twenty years ago)
― xhuxk, Tuesday, 14 February 2006 23:37 (twenty years ago)
― xhuxk, Tuesday, 14 February 2006 23:38 (twenty years ago)
"Soft and subtle, Superwolf is the kind of record that unwinds slowly, and is best enjoyed over multiple listens and, unsurprisingly, many glasses of wine. Oldham and Sweeney mew coquettishly, stroking their guitars, cawing bizarre stories about love, death, and body parts: theirs is a rancid and beautiful landscape."
Appears to be serious crap, xhuxk.
― George the Animal Steele, Tuesday, 14 February 2006 23:46 (twenty years ago)
― blackmail (blackmail.is.my.life), Tuesday, 14 February 2006 23:52 (twenty years ago)
― xhuxk, Wednesday, 15 February 2006 15:57 (twenty years ago)
I kind of really like the Oceansize cd. It moves really fluidly. It reminds me slightly of Alice In Chains but maybe more like something Jerry Cantrell would do solo. Either way, it was a nice surprise. And Xhuxk, that Sword cd sounds like one long highly-combustible Queens of the Stone Age song but without swinging.
― Je4nn3 ƒur¥ (Je4nne Fury), Wednesday, 15 February 2006 16:19 (twenty years ago)
― George the Animal Steele, Wednesday, 15 February 2006 16:46 (twenty years ago)
Plus, on the second disc is a 1998 show, which is fair to good, one of my favorite parts being "In the Beginning." And piano blooz, which isn't a surprise if you listen closely to what Emerson used to play, but would be a surprise to the people who've written them off as the worst excess of prog.
Powerful band at a real budget price. Nice packaging, too. I would have put this on the art metal thread but it's too difficult to take seriously what with the citations of Sleepytime Gorilla and other cabaret acts that don't rock.
― George the Animal Steele, Wednesday, 15 February 2006 19:57 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 15 February 2006 20:10 (twenty years ago)
― xhuxk, Wednesday, 15 February 2006 21:05 (twenty years ago)
― xhuxk, Wednesday, 15 February 2006 21:23 (twenty years ago)
― xhuxk, Friday, 17 February 2006 00:34 (twenty years ago)
― Ned Raggett (Ned), Friday, 17 February 2006 02:09 (twenty years ago)
― xhuxk, Friday, 17 February 2006 02:17 (twenty years ago)
― xhuxk, Friday, 17 February 2006 02:50 (twenty years ago)
― blackmail (blackmail.is.my.life), Friday, 17 February 2006 02:52 (twenty years ago)
You gotta be kidding me. They backed David Allen for a Gong record -- Acid Mothergong, I think -- and he made them stick to mostly three and four minute numbers.
Now technically, there are a couple twenty minutes numbers on Emerson, Lake & Palmer's Then & Now but they're really not one long number, but a series of shorter tunes, some of which got passed off as pop on the radio. Like twenty minutes of "Take a Pebble Suite" has "Still You Turn Me On," "Lucky Man" and a couple other things in it.
― George the Animal Steele, Friday, 17 February 2006 03:10 (twenty years ago)
― George the Animal Steele, Friday, 17 February 2006 03:13 (twenty years ago)
alien 8 (out of, uh, quebec i think.) doubt i'll listen to it again, to be honest. life is short.
― xhuxk, Friday, 17 February 2006 03:47 (twenty years ago)
― blackmail (blackmail.is.my.life), Friday, 17 February 2006 09:45 (twenty years ago)
Got the 2nd Toxic Holocaust record the other day. Best MD-based one man trad thrash band I've heard. Nice Ed Repka cover too.
― adam (adam), Friday, 17 February 2006 15:23 (twenty years ago)
― scott seward (scott seward), Friday, 17 February 2006 15:28 (twenty years ago)
― xhuxk, Friday, 17 February 2006 15:37 (twenty years ago)
― pdf (Phil Freeman), Friday, 17 February 2006 15:55 (twenty years ago)
― scott seward (scott seward), Friday, 17 February 2006 15:59 (twenty years ago)
― xhuxk, Friday, 17 February 2006 16:17 (twenty years ago)
What's the racket with getting promotional copies? Just don't say even remotely indifferent things?
― George the Animal Steele, Friday, 17 February 2006 16:32 (twenty years ago)
― pdf (Phil Freeman), Friday, 17 February 2006 16:36 (twenty years ago)
you can give them to me if you want! i don't think i've ever heard mott the hoople on cd.
― scott seward (scott seward), Friday, 17 February 2006 16:39 (twenty years ago)
That's the administrative plan of a certified dumbass. Those who would be the most able to address a copy of a Mott reissue are for want of a better term, older. And they're the people who are most likely to not have the time or the inclination -- or even the desire -- to fiddle around on the Internet downloading a digital image of the LP.
Anyway, it's a good record. Ariel Bender is on it. I descratched a digital copy of my vinyl a few years ago and made a good CD-R of it. "Crash Street Kids" is my favorite but "The Golden Age of Rock 'n' Roll" and the song Overend Watts sings that began the second side are also real good.
― George the Animal Steele, Friday, 17 February 2006 17:07 (twenty years ago)
― xhhuxk, Friday, 17 February 2006 18:13 (twenty years ago)
― xhuxk, Friday, 17 February 2006 18:23 (twenty years ago)
― xhuxk, Friday, 17 February 2006 18:28 (twenty years ago)
― xhuxk, Friday, 17 February 2006 18:41 (twenty years ago)
I don't hear Living Color. Maybe a little King's X. There was a Brit band I have buried in my piles somewhere that sounded like this but damned if I can pull 'em out right now. (Ha-ha, yeah, I know, piles.)Might've or might not've been Baker-Gurvitz Army. They were totally hookless but very tight and funky.
And when I first put it on I thought the singer was sort of sounding like Eddie Vedder but the more I listened, it was just a minor coincidence. Nothing in common with Pearl Jam for which I am greatly grateful.
― George the Animal Steele, Friday, 17 February 2006 19:27 (twenty years ago)
― pdf (Phil Freeman), Friday, 17 February 2006 20:21 (twenty years ago)
If the hard rock numbers, of which there are about three, are supposed to be great, in 1975 these boys easily get stomped by second and third tier white boy blooz bands in the arenas. "Alice in My Fantasies" is the best of them, but it's brief. "Red Hot Mamma" has way too much George Clinton cough syrup and speed freak vocal bullshit at the beginning. "Jimmy's Got a Little Bit of Bitch In Him" is average -- probably seemed audacious at the time because it was about the down low -- but Frank Zappa & the Mothers were doing a lot like it a few years earlier. "Good Thoughts, Bad Thoughts" is sub-Hendrix guitar wank from Eddie Hazel who I assume often did better and more George Clinton theology through cough syrup recitation. Album art is great, so are the liner notes. Title cut is OK but the funk ain't THAT funky and the best part again is Hazel's guitar. It's better as the single edit on the bonus tracks because it's shorter. And "Vital Signs" is a funky hard rock instro which is fair, included as a bonus cut.
Title of songs, I've noted in the Funkadelic catalog, are often actually better than the songs themselves, what I've heard of them, anyway.
― George the Animal Steele, Friday, 17 February 2006 21:06 (twenty years ago)
I liked when Dirty Tricks did it to, which was usually in the long parts between the beginning and the end of the tunes where they tacked on semi-pop bits to satisfy the record company or the producer or someone.
― George the Animal Steele, Friday, 17 February 2006 22:35 (twenty years ago)
― xhuxk, Friday, 17 February 2006 23:12 (twenty years ago)
I was gonna blow off Opeth because I do not like Opeth (please don't yell, I gave them many, many opportunities to blow me away, live and on disc, and it never seems to happen) however I think I'll go to see Devin at work. I wonder if Gene Hoglan is still playing with him...
― Brian O'Neill (NYCNative), Saturday, 18 February 2006 11:16 (twenty years ago)
Just so happens my copy wasn't stuffed away in a box somewhere so I checked. I see what you mean. I used to have Funkadelic on vinyl. I think I traded it because it was really aimless and psychedelic in a piss poor fashion. Kept Maggot Brain which I haven't listened to in a decade. Standing On the Verge is entertaining with the silly voices rhyming about being a tree, so if you'll be my dog pee on me and the hoary "the angle of the dangle increases with respect to the heat of the meat" or whatever in the homosexual tune. But it's funny once or twice and then turns into a novelty record. It's like an X-rated version of Crazy magazine.
It just never really rocks or funks as much as you think it might oughta and Clinton's Ayn Randian goes hippie and god-believin' philosophy of life in cough syrup screwed vocals grated after two listens, irrespective of Eddie Hazel's guitar. FZ did that stuff better, did better R&B when he wanted to, and really played a much more flaming axe.
The cover art on those things is terrific. I'm glad I didn't get sucked into buying two of them. Was thinking of going for Let's Take It to the Stage because the title, "No Head, No Backstage Pass" stuck out.
My other question has nothing to do with reappraisals of Funkadelic.
Has anyone noticed the creeping trend of putting music mags in sealed bags and stuffing a CD in with them that you don't want to jack up the price and make them unbrowsable? Jeezus, it happened to Guitar World which I occasionally bought and won't forever now. I thought this was only a practice of English mags that I see on the rack in Tower. The idea is to jack up the mag to the price of a mid-list CD by adding a CD of new artists, gimmicks or total rubbish you would never buy and don't want, and glue it to the cover or put it in a sealed bag with the publication. What kind of strategy is that?
― George the Animal Steele, Saturday, 18 February 2006 17:17 (twenty years ago)
This follows last Sunday's entry, You Know That Just Ain't Right:Blurb in Amoeba's ad in the Sunday LA Times on an instore show by Wolfmother -- "Like the bastard son of Uriah Heep and Jimi Hendrix..."
Uriah Heep, Jimi Hendrix, Black Sabbath, Led Zeppelin. That about cover's it. Wolfmother, the magic elixir of heavy rock, including everything for all people who don't like hard rock, have to write about it once or twice, and have this to glom onto.
― George the Animal Steele, Saturday, 18 February 2006 20:11 (twenty years ago)
In the 99 cent bins at the used store in Pasadena was a promo copy of the Big F's debut from the late Eighties-early 90's on Elektra. It was amusing because it came packed with all the hype from the various slum pubs. Lonn Loves It! That was one claim, apparently stemming from a review of Lonn Friend. Was he in A&R or still doing RIP or was RIP R.I.P by then? Good review from Kerrang. I'm amazed they were signed to a major at all. There isn't even a shred of a tune on this thing. It sounds great while it's playing though -- hard rock/metal jam rock and incomprehensible stream of consciousness singing while it's going on. You just can't remember most of it once it's gone past. "Dr. Vine" is about the most memorably, mostly because of the title.
Good match-up with Cargun who are philosophically in the same place. Only Cargun is a lot better, funkier, more solid. But for 99 cents it's impossible to go wrong with the Big F's debut. Did anyone ever see this band? It kind of looks like they may not have been entirely a southern California fiction that scored a record deal. When I was at the newspaper I got a cassette EP with them on it, although I can't remember the songs, naturally.
And last, Focus's 8. Now, if you liked Focus at all originally, you'll like this. It's only Thisj van Leer and a backing band, but the backers were a Focus tribute act in Holland or somewhere, and they sound exactly like the originals. Even the guitarist sounds like Jan Akkerman, which is a pretty good trick. The CD sticks to the Focus formula of van Leer yodelling, humming, whistling and handclapping over instrumental work. His flute's in their and they quote from old themes, you particularly hear "Hocus Pocus" coming in and out of the mix and the first tune, "Rock & Rio," really does rock. In fact, over half of it does, the rest being prog jazz fusion and aerobatic guitar.
― George the Animal Steele, Sunday, 19 February 2006 17:51 (twenty years ago)
― pdf (Phil Freeman), Sunday, 19 February 2006 17:56 (twenty years ago)
The Big F certainly got the full measure of review from the Brits. Three different pieces from their Marquee show alone, which seemed to have been a disaster. Obviously, no one was buying the Big F anywhere. But I still think it's a good record, just one that would have been impossible to sell to a hard rock audience in 89-93. Grunge didn't do them in. It wouldn't have mattered what was the dominant fad.
Anyway, someone has to make hard rock that sounds great but you can't remember five minutes after it's been on the turntable. I'm joking a little, but it's a valid style. It certainly exists in jazz but for hard rock bands doing the same kind of improvisation, it's a no-go zone. I'm glad I have the Big F vinyl.
― George the Animal Steele, Sunday, 19 February 2006 18:35 (twenty years ago)
So question - what do I need from Uriah Heep, if anything at all? Demons And Wizards seems like the default pick, but is there a quality best-of that adequately summarizes all their other records, the way there is with Atomic Rooster?
― pdf (Phil Freeman), Sunday, 19 February 2006 19:32 (twenty years ago)
Jasper and Oliver compare Dirty Tricks (who I've always mixed up in my head with Dirty Looks, not sure if I've ever even heard the former actually) to "heavy metal Bad Company."
Popoff seems to slightly prefer Dirty Looks to Dirty Tricks.
Uriah Heep made a few solid albums, which I'll let George detail, but there actually IS a good two-disc CD comp: *Classic Heep: An Anthology* (came out on Mercury, 1988).
― xhuxk, Sunday, 19 February 2006 19:41 (twenty years ago)
http://www.google.com/musicl?lid=-WVQzC3cWrL&aid=Hu6LI5Ei5WN
and it's cheap, i say go for it. very 'eavy...very 'umble and look at yourself are both great and salisbury is good too. if you like those, then you can go further. Castle did the remaster/bonus/live treatment to a bunch of their records. i would buy those cd versions. again, on vinyl you are talking 30 bucks tops for their entire catalogue :)
― scott seward (scott seward), Sunday, 19 February 2006 19:45 (twenty years ago)
Dirty Tricks didn't sound like Bad Company. Their singer and Cargun's are similar, with the soul man thing going on. DT were veddy British, weren't good with writing discernible songs, but they had the heavy riff vibe. Their material churned, stopped and started, went thump thump in all the right places. They were blocky and tough-sounding, did a Cat Stevens cover in a way that you wouldn't recognize it, and I really like their songs "Night Man" and "Hire Car," the latter which is about them getting to go down the motorway to the next gig in a hired car, a damn sight better than the usual no car or beater that they had, I think. And unlike most songs about going down the highway, it is not fast. Dirty Tricks were able to make slow and slow medium tempo stuff sound good.
Uriah Heep: immediately go for Very 'eavy as it has the killer "Gypsy" and "Dreammare" on it. Look at Yourself is a mostly guitar and organ fast boogie shuffle record, and it is as quick and aggressive heavy rock and roll as they ever made. "Love Machine" is the standout cut. Salisbury, as Scott said, is also a good one but different than standard Heep. One side was their collection of singles for the time -- "Bird of Prey," etc., the remaster included "Simon the Bullet Freak" which is simply OK but was supposed to be thought of fondly when it was issued. The reason to listen is the whacked out symphony prog piece on the second side with blaring horns, wah-wah guitar and the kitchen sink thrown in.
Demons & Wizards is fair because of "The Wizard" and "Easy Livin'" although I don't listen to it anymore. It was their breakthrough record in the States. I immediately bought "Live in '73" or "Heep Live" or whatever it was called and liked that a lot more because it had all the songs on it, songs which had been albums that weren't in the local shops when Heep broke. As Heep sold more, the back albums were once again stocked. The Magician's Birthday is fair. It has poor production and the "opera," The Magician's Birthday, is the only good reason to listen. Why? Again, because it's totally ridiculous and over the top in the way only Heep was doing. It's the last of Heep's good albums.
Wonderwall -- yechh, except for "Suicidal Man." The album with "Sweet Freedom" and "Stealin'" on it, double yechh. Surprisingly, the tours were still good. "Return to Fantasy" -- biggest selling album at the time, people buying it out of wishful thinking and hopefulness the slide would reverse. Christ, it's awful. The only more awful is "High & Mighty," the last album with David Byron before they kicked him out for being a raging cokefiend and boozer, as opposed to being only the half-assed cokefiends and raging boozers the rest of them were. Firefly is the first album with the lead singer from Lucifer's Friend, who were the poor man's Uriah Heep. It's the best of the trio he did with them and I have a fondness for it but usually the Heep fans have no use for it or anything from that period.
― George the Animal Steele, Sunday, 19 February 2006 20:14 (twenty years ago)
It was Big F's EP. I checked and it's one of those the Amazon merchants sell for around ll cents. Actually, it's not really 11 cents, the profit it made in the postage, but it still comes out to pretty cheap. Maybe not as totally cheap as the 99 center in the bin at Penny Layne or the 25 centers and carry it out at Canterbury, both on Colorado, but still pretty damn inexpensive.
― George the Animal Steele, Sunday, 19 February 2006 20:22 (twenty years ago)
― scott seward (scott seward), Sunday, 19 February 2006 20:37 (twenty years ago)
Back in high school, we were able to convince a classmate that Dirty Looks' "Oh Ruby" was a long-lost AC/DC song...
― a. begrand (a begrand), Sunday, 19 February 2006 23:32 (twenty years ago)
― Brian O'Neill (NYCNative), Sunday, 19 February 2006 23:39 (twenty years ago)
But back to Big F. They don't have a singer really, but a ranter. The formula was to seize on a phrase, like the title, and curse it out over the backing din, which was real good, again and again. "Don't kill the cowboy! "Lies, lies, lies!!!" "Hey monkey boy!" "Walk away, walk away walk away!!!!" Listening to it again this afternoon. It's entertaining.
And I've not found anything on Authority's "Are You Authorized?" which seems like a play on "Are You Experienced?" A drive-by download, it's an unusual record that about halfway through flips into Eighties ZZ Top-land. The first half is Pink Floyd-y crypto-metal with some nu-metal flourishes. But the second half, anyway, equals ZZ Top. "I Take the Zero" is almost indistinguishable and may in fact be a direct rip of "I Got the Six" from Eliminator. It's not actually direct but I'm hearing it as clever attribution.
― George the Animal Steele, Monday, 20 February 2006 00:15 (twenty years ago)
― George the Animal Steele, Monday, 20 February 2006 00:45 (twenty years ago)
― xhuxk, Monday, 20 February 2006 01:25 (twenty years ago)
My choice was Early Man and the Sword at Spaceland in Silverlake. Wow! I stayed home and listened to ELP and Sugarcreek on TEN which you can do in Pasadena if you live in a house. I'm sure it was louder than anything in Silverlake. When "Tocatta" came on, the cats' tails frizzed out and they ran for cover. I even played Pictures at an Exhibition TWICE, and if that's not metal, I don't know what is.
In keeping with Scott's frugal recommendations: Like the Uriah Heep "three-for", there is an ELP "three-for" (ELP/Tarkus/Pictures at an Exhibition") remaster from Castle for 22 bucks that is a goddamn steal and relentlessly attacking and pastoral prog metal with keys mostly in place of guitars, '71-72. With Then & Now for 11 bucks at BestBuy, you have the essentials of the catalog for a little over thirty dollars, which is a little more than you would pay for really clean vinyl of the functionally same material.
― George the Animal Steele, Monday, 20 February 2006 11:53 (twenty years ago)
ELP, Best Of (the one with the white cover that has the full-length "Tarkus" on it)Atomic Rooster, Heavy Soul: The AnthologyThe Groundhogs, Split, Thank Christ For The Bomb and Live At Leeds '71The Big F, s/t (three cents plus $2.49 for shipping)Lynyrd Skynyrd, The Essential Lynyrd Skynyrd (2CD set marked down to $14.97, and it has every song I'll ever want to hear)
― pdf (Phil Freeman), Monday, 20 February 2006 14:00 (twenty years ago)
― pdf (Phil Freeman), Monday, 20 February 2006 14:02 (twenty years ago)
― scott seward (scott seward), Monday, 20 February 2006 14:16 (twenty years ago)
Cowboy Mouth's *Voodoo Mouth* has a song called "I Told Ya" on it that vaguely reminds me Electric Six, though Joe McCombs will compare a couple tracks to Kiss and the Flamin' Groovies in the *Voice* soon, and I don't know if that was one of those or not. Most of the CD seems to alternate between Barenaked Ladies and pop-punk, though: pretty wretched. (I never heard the band before myself, and doubt I will again. They're from New Orleans, whose current plight they're also said to address on this album, though I haven't noticed.)
from the world music thread:
Playing the two-disc (including live disc) Columbia/Legacy reissue of *Santana III* (an album I don't remember actually ever hearing before) again this morning, after playing it a lot over the weekend. It kicks ass. Not sure if this is their most metal album or not, but it's got to be up there -- it's sort of a crime that I put so many Funkadelic albums in *Stairway to Hell* and no Santana ones. Plus: Reissue has THREE versions of "No One to Depend On" (album, single, live), and I *still* don't get tired of hearing the tune -- right now it just went into a riff that Babe Ruth later bit, in "Joker" I think. (And didn't some rap hit sample the chorus a few years ago? I forget what. One more thing reggaeton should be doing.)
not from world music thread:
ELP didn't make *Stairway* either, which was pretty stupid. I need to catch up with them someday. (I did tape their King Biscuit Flour Hour special off the radio once, however.)
― xhuxk, Monday, 20 February 2006 14:23 (twenty years ago)
― xhuxk, Monday, 20 February 2006 14:25 (twenty years ago)
― pdf (Phil Freeman), Monday, 20 February 2006 14:30 (twenty years ago)
― scott seward (scott seward), Monday, 20 February 2006 14:37 (twenty years ago)
― pdf (Phil Freeman), Monday, 20 February 2006 14:50 (twenty years ago)
― scott seward (scott seward), Monday, 20 February 2006 15:03 (twenty years ago)
― scott seward (scott seward), Monday, 20 February 2006 15:12 (twenty years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Monday, 20 February 2006 15:19 (twenty years ago)
http://www.villagevoice.com/music/0531,smith,66384,22.html
― xhuxk, Monday, 20 February 2006 15:27 (twenty years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Monday, 20 February 2006 15:33 (twenty years ago)
― scott seward (scott seward), Monday, 20 February 2006 15:37 (twenty years ago)
http://www.leisureclass.net/glenn/photo/sirens.jpg
― scott seward (scott seward), Monday, 20 February 2006 15:42 (twenty years ago)
xhuxk, you're not the only one to overlook ELP. Popoff seems to have a total blindspot. There's nothing in his metal book, or in his 70's book on hard rock -- even in the appendices, on ELP. ELP were a lot more direct and harder sounding than Yes when they wanted to be. The first album, the one with the dove on the cover, really rocks on the songs you think it will -- "The Barbarian," "Knife-Edge," and the last band ensemble part of "Tank."
In fact, I don't quite understand now why they got such a lathering. A lot of it is pure classic rock, with keys in place of the guitar, usually with Emerson's velocity and oomph filling in for the axe power chord. They did piano boogie, straight boogie and surprisingly often, snuck the Led Zeppelin "How Many More Times" riff into parts of their "prog" tunes.
Anyway, in Tower yesterday I noticed Mojo of Metal Hammer or some Brit mag had a "Classic 70's" issue. I paged through it, was fairly good. I'd have bought it if I didn't have all the stuff in it, but it's good for people who don't. The only thing I had argument was their section on Power Pop where they throw in Big Star. Big Star was never big in or even semi-obscure in the 70's. They were just nowhere no matter how many times you watch "That 70's Show." At least it seemed that way to me. No one was playing the street song. Critics writing about Big Star after the 70's, usually in the 90's, made Big Star seem influential in the 70's.
And ELP wasn't properly represented in the prog part. Their first few albums all charted and sold millions. They were way bigger than Genesis. They headlined California Jam in '74 over Deep Purple, who was second, and Black Sabbath, who was third. Distantly at the same gig were the Eagles and Earth, Wind & Fire.
You really don't get more metal than "Karn Evil 9": "Let the bridge com-pu-ter speak! Guardian of a nuclear dawn!" Then the "Bridge Computer" speaks: "STRANGER! LOAD YOUR PROGRAM! I AM YOURSELF!"
Anyway, with the Giger cover and all the techno-war imagery (The Tarkus, a giant armadillo grown out of a tank, the Manticore and the Karn Evil 9 thing), you'd think more people would have gotten the metal connection. It must be that they were so trashed by journalists after 75 or so, a practice that has never let up. Christ, the band even had a sense of humor. If they were pompous, I missed it, must have happened when "Works" came along, which I never signed on for.
― George the Animal Steele, Monday, 20 February 2006 18:17 (twenty years ago)
― scott seward (scott seward), Monday, 20 February 2006 18:30 (twenty years ago)
― xhuxk, Monday, 20 February 2006 19:02 (twenty years ago)
Mr. Trucks uses a slide on his fretting hand and picks the strings with his fingers.
No shit, Sherlock. Guitarists use the slide on their "fretting" hand and pick strings with their fingers. Wow. Spell it out for the ET's in your readership, who maybe don't have hands and are unfamiliar with guitarists in bars and on TV because they're from Alpha Centauri.
And this, well there's just no equal:
One example is in "Sahib Teri Bandi," a nearly 10-minute qawwali piece from Nusrat Fateh Ali Khan's repertory, built on a steady drone.
Derek Trucks, nope he doesn't rock. And that sentence tells ya all ya need to know. It's so Timesian arts section, it's a parody of its own style. You just know those upper middle class intellects are hanging on the latest news about reuse of qawwali from Muskrat Fateh Ali Khan.
― George the Animal Steele, Monday, 20 February 2006 19:18 (twenty years ago)
― pdf (Phil Freeman), Monday, 20 February 2006 19:38 (twenty years ago)
― George the Animal Steele, Monday, 20 February 2006 20:52 (twenty years ago)
― pdf (Phil Freeman), Monday, 20 February 2006 20:58 (twenty years ago)
Since there is apparently (and bizarrely) no "Rolling 2006 hip-hop thread" on ILM, I will note here that I really like the apparent '70s hard rock riff in "My Favorite Mutiny," track #4 on the new Coup album *Pick a Bigger Weapon* (due out 4-25). At first I was thinking the riff might have come from the Stories' version of "Brother Louie," but now I am leaning toward "maybe something by Redbone." (I own one Redbone album, which I bought cheap a couple years ago, but I sadly have far from an encyclopedic knowledge of their riffs.)
― xhuxk, Monday, 20 February 2006 22:33 (twenty years ago)
― xhuxk, Monday, 20 February 2006 22:39 (twenty years ago)
― a. begrand (a begrand), Tuesday, 21 February 2006 00:45 (twenty years ago)
― Brian O'Neill (NYCNative), Tuesday, 21 February 2006 07:40 (twenty years ago)
― pdf (Phil Freeman), Tuesday, 21 February 2006 13:08 (twenty years ago)
And which bands are you talking about here?I think I shall disagree mightily with you anyway somehow..
― Last Of The Famous International Pfunkboys (Kerr), Tuesday, 21 February 2006 18:27 (twenty years ago)
― pdf (Phil Freeman), Tuesday, 21 February 2006 19:20 (twenty years ago)
― pdf (Phil Freeman), Tuesday, 21 February 2006 20:27 (twenty years ago)
Funkadelic's Standing On the Verge of Getting It On, from '75.For one, Foghat smoked Funkadelic's feeble stabs at hard rock. Theyhad a way better singer, too. Deep Purple. Anyone with a white Hendrix imitator generally did better than Eddie Hazel, in this case Trower comes to mind. Even Come Taste the Band -- which is Purp's explicity funk record -- is better than Standing. Frank Zappa smoked Funkadelic, and they seemed to be copying from him quite a bit in term of committing weird and zany to vinyl. But if you need some barrel-scrapers, Tin House, the And part of Johnny Winter And, Stretch, Hustler, REO's first and second album when they were stillbarrel-scraping...
I think I shall disagree mightily with you anyway somehow..
It goes without saying.
― George the Animal Steele, Tuesday, 21 February 2006 20:48 (twenty years ago)
― scott seward (scott seward), Wednesday, 22 February 2006 01:06 (twenty years ago)
― scott seward (scott seward), Wednesday, 22 February 2006 14:47 (twenty years ago)
ha ha, I do this with books ALL THE TIME. Sometimes with just 20 pages left! Most recent ones: *Middlesex* and *A Confederacy of Dunces.* Maybe ending books is just hard for *authors*; I don't know.
― xhuxk, Wednesday, 22 February 2006 14:52 (twenty years ago)
― scott seward (scott seward), Wednesday, 22 February 2006 15:01 (twenty years ago)
― scott seward (scott seward), Wednesday, 22 February 2006 15:04 (twenty years ago)
A clue:
http://villagevoice.com/pazzandjop05/ballots.php?mid=2125
Just got this via email by the way:
FOR IMMEDIATE RELEASE
February 22nd, 2006New VOIVOD album title revealedCanada’s pioneering metal band VOIVOD have set “Katorz” as the title of their forthcoming album due out late spring on THE END RECORDS in North America.VOIVOD, who just finished mixing the album with producer Glen Robinson (Tea Party, GWAR) at Multisons studio in Montreal, Quebec, Canada, are now mastering the album in New York.The follow-up to 2003's "Voivod" is the first album in the band's 20-plus-year career that did not feature founding guitarist Denis "Piggy" D'Amour working alongside his bandmembers in the studio. D'Amour died August 26, 2005 in a Montreal hospital from complications of advanced colon cancer.In order to record “Katorz,” drummer Michael "Away" Langevin, singer Denis “Snake” Belanger and bassist Jason "Jasonic" Newsted utilized all of the guitar parts that Piggy had recorded for the record on his laptop with ProTools before his death.
― xhuxk, Wednesday, 22 February 2006 15:16 (twenty years ago)
I was surprised recently when visiting youtube.com that Mille of Kreator is wearing a Bad Religion shirt in the "Betrayer" video, something I didn't recall from when I last saw the video, well over a decade ago...
― Brian O'Neill (NYCNative), Wednesday, 22 February 2006 15:21 (twenty years ago)
Ah, right!
And apparently, Voivod recorded enough stuff from piggy's finished tracks for two albums. so, another album of that stuff will come out next year or whenever. not tupac territory, but still, not something that happens every day.
― scott seward (scott seward), Wednesday, 22 February 2006 15:47 (twenty years ago)
Someone should have brought them to the States and paired 'em with Early Man. The title cut, "Dead Gone," another mercilessly hammering purist metal riff that uses dynamics, going from raging and kick-ass to chopping rhythm and cantering snare groove, no one messing it up with any vocals. Then silence and power guitar and drum chomps and back to elephants trampling the pygmies stupid enough to go into the jungle in the afternoon when they start jumping out of trees, or however the old pachyderm joke went from my grade school book of one thousand elephant jokes.
― George the Animal Steele, Wednesday, 22 February 2006 23:01 (twenty years ago)
"Breakdown," second tune of Gone Dead also raging.
― George the Animal Steele, Wednesday, 22 February 2006 23:05 (twenty years ago)
― George the Animal Steele, Wednesday, 22 February 2006 23:31 (twenty years ago)
― George the Animal Steele, Thursday, 23 February 2006 01:03 (twenty years ago)
― pdf (Phil Freeman), Thursday, 23 February 2006 01:43 (twenty years ago)
― adam (adam), Thursday, 23 February 2006 02:00 (twenty years ago)
― Brian O'Neill (NYCNative), Thursday, 23 February 2006 02:02 (twenty years ago)
― scott seward (scott seward), Thursday, 23 February 2006 02:32 (twenty years ago)
― adam (adam), Thursday, 23 February 2006 02:36 (twenty years ago)
― A Fire Inside, Thursday, 23 February 2006 14:16 (twenty years ago)
― Utumno1, Thursday, 23 February 2006 14:23 (twenty years ago)
Chuck, thanks for the Copperhead cd. I dig it. I'm gonna have to make a copy for my dad. He would love it. My dad is the only person I ever knew who owned every Doc Holliday album. I might have to send him the live Molly Hatchet dvd/cd i got too. He loved the last studio album I gave him. The Copperhead is actually better than the new live Hatchet, but the new live Hatchet suffers from a muddy live mix.
That Craft album is soooooo groovy. Glad I picked it up.
― scott seward (scott seward), Thursday, 23 February 2006 14:41 (twenty years ago)
I will take my son out of private school to pay for the release of this album. Hell, I'll make him work the taxi stands if that's what it takes. RECORD IT AND SEND ME THE TAPES NOW NOW NOW
― Thomas Tallis (Tommy), Thursday, 23 February 2006 14:51 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Thursday, 23 February 2006 15:05 (twenty years ago)
― rizzx (Rizz), Thursday, 23 February 2006 15:08 (twenty years ago)
oh no, i like them okay. i was just going along with the hate vibe.
― scott seward (scott seward), Thursday, 23 February 2006 15:29 (twenty years ago)
no, i haven't!
― scott seward (scott seward), Thursday, 23 February 2006 15:30 (twenty years ago)
http://www.aurora-b.com/fungal.php
― scott seward (scott seward), Thursday, 23 February 2006 15:35 (twenty years ago)
― scott seward (scott seward), Thursday, 23 February 2006 15:38 (twenty years ago)
Do you like Khanate and Earth? I'm disappointed that posted didn't mention them.x-post.That moss album is very good. As was the split with Wolfmangler(whom i like very much)
― Last Of The Famous International Pfunkboys (Kerr), Thursday, 23 February 2006 15:47 (twenty years ago)
Suggestion: Put this in a graf with my dog only shits to open chords and send it to the Onion. How many times has someone seen a ridiculous review of Sunn making a reference to bowels moving or innards shaking?
And I am at the root of Copperhead discovery. All rock critic distro are belong to me. Live and Lost nowhere without my duplication.
The Scabs were Belgium's biggest native band in 1988, it says here on my digital cribsheet.
I have a pamphlet called Lower GI Endoscopy from Krames, makers of endoscopes. I'm astonished, astonished that no urban slum metal band has yet taken full advantage of the inspirational facts, names, titles and research material in such a thing for an album. Oh yes, sure there have been feeble attempts and the endless fascination with utilitzing titles that seem to be cribbed from medical books. But they're often not real titles, they're made up, the work of amateurs. Those who have spent time in the research library of a medical library know it to be true.
The art on Krames' "Viewing Your Colon" is just waiting to be lifted. It has an artist's conception of a polyp and a black tube that holds the seeing eye... Fifty percent of the people who see it for the first time get a slight stomach cramp it's so convincing.
Colonoscopy has just put an MP3 teaser on their myspace page, in advance of their highly anticipated new album, The Procedure, on Aquarius Records. The mini opera, "Pain In Your Abdomen/Fever/Get Someone To Drive You Home" has already been downloaded ten thousand times.
― George the Animal Steele, Thursday, 23 February 2006 15:53 (twenty years ago)
― rizzx (Rizz), Thursday, 23 February 2006 15:57 (twenty years ago)
― George the Animal Steele, Thursday, 23 February 2006 16:01 (twenty years ago)
― rizzx (Rizz), Thursday, 23 February 2006 16:06 (twenty years ago)
These reviews of Ephel Duath were hysterical. Unintentionally good ones too, because now I know to cross the street when I see ED coming.
And how 'bout Sourvein inflating their glorified extended single by 100 percent with a 13-minute noise cut. Penalty! Personal foul: Unnecessary stuffness! Fifteen yards and loss of down. Next flag ejects them from game.
― George the Animal Steele, Thursday, 23 February 2006 19:43 (twenty years ago)
Anyway, atrocious escapades at SIR rehearsal studios and the House of Blooz in LA. Middle-aged accountant, surgeons, dentists, a slumming lottery winner, and the occasional dopey kid or girl, sign up to be in lottery-chosen bands coached by Simon Kirke, some guitarist from Great White, Brett Michaels, Jack Blades and another guy from Nightranger and a truly abominable looking Elliot Easton from the Cars. Hey, it's natural not to look good well into middle age but Easton really pushes out to the cutting edge. He's so far out in front of everyone else it's made him churlish and mean to his students, who more or less call him on it. Maybe it sucks being in Creedence Clearwater Revisited now that John Fogerty has the big CD in stores.
Hosted by a typically oily twenty-lowthirty something, Even Farmer.
Almost everyone sings flat in this show except Roger Daltrey. Painfultroubles with vocal intonation. In the big climax, the lottery bands compete doing covers of Who tunes with Daltrey as front man. Often the players are so inept, their guitars are audibly out by a half-step or two. Every song is played too slow, as if by old men. None of the people know how to hold their guitars or play without looking at their fingers and the fretboard. They're all given premium instruments and it doesn't matter.
Daltrey lies continually near the end, assuring everybody that they're doing a good job. They're not. Daltrey remains an unflappable sport and gamer. A crowd of yahoos -- many of them really dumb-looking young boys and girls -- are let into the House of Blues from the street to continually throw the horns at whatever camera is pointing at them. Two surgeons are interviewed continually -- one a guitarist who can't play, the other a neurosurgeon who appears as if someone's induced spasticity in him before he hits the stage to sing.
It's hard to imagine anything worse. I was able to watch Dealing Dogs, a graphic documentary about animal cruelty on HBO all the way until the end because while it showed abominable behavior to dogs, there were morals to it, eventual retribution, rescue and a just ending. Rock and Roll Fantasy Camp was just abominable. It served no purpose but the taking in of money and the gratification and stroking of people who had been paid to be told fibs by their betters who have fallen on financial hard time. It was a glorified whorehousewhere the graying pigs are told they're still hard and vigorous by the lap dancers. It had no morals and if you had a shred of sense about you, it made your skin crawl.
― George the Animal Steele, Thursday, 23 February 2006 20:19 (twenty years ago)
― xhuxk, Thursday, 23 February 2006 20:31 (twenty years ago)
― Pashmina (Pashmina), Thursday, 23 February 2006 20:52 (twenty years ago)
― xhuxk, Thursday, 23 February 2006 20:54 (twenty years ago)
Purposely seemed to have the worst camera angles, edits and lighting, too. Went out of its way to show people with awful hair, the unsightly blemishes/actinic scars on faces, Roger's tobacco-stained teeth, the wrinkly relaxed fit jeans, cabooses as wide as barn doors, eyebags. The show's cinematrography was sadistic. It made everyone look like the homeless men you see begging for money at the Alvarado exit off the Hollywood Freeway. I swear they were even wearing plastic bracelets. The homeless men get them when they're dumped out of the emergency rooms onto skidrow. I don't know why the contestants were wearing them.
― George the Animal Steele, Thursday, 23 February 2006 21:03 (twenty years ago)
From The International Encyclopedia of Hard Rock & Heavy Metal, suitable beverage-stained, "The Imps [featured] the enigmatic and downright dangerous Frank Soda. Soda [appeared] onstage in all kinds of weird outfits, including the wearing of an exploding television on his head. {The latter has been mentioned by Thor, in An-Thor-Logy, I think.) The music...owes a great deal to Cheap Trick."
And the Imps, listed here, sounds like it was made with Thor ca. 1980. Info is spotty. Natives feel free to fill in the blanks and make corrections.
― George the Animal Steele, Thursday, 23 February 2006 21:29 (twenty years ago)
It also has some in common with old LA AOR glam pomp act, Fortune, a record I dropped in here last week for a one-shot when it made it to CD digital land for the first time. Above all, the guitar mix and tone sets this out from the style as it's, it's....it's CRUNCH.
― George the Animal Steele, Friday, 24 February 2006 01:59 (twenty years ago)
― xhuxk, Friday, 24 February 2006 02:14 (twenty years ago)
Anyway, fukc me, "Friday" by Derin Dow is playing -- the first cut on the CD -- and the reason it sounds so Eighties and CRUNCHING is because the rhythm guitar is Eddie van Halen-tone! And Lou Gramm is singing, so xhuxk's right on about him sounding like Foreigner dude for one tune. Third tune again gets a lot from Foreigner.
― George the Animal Steele, Friday, 24 February 2006 02:34 (twenty years ago)
― George the Animal Steele, Friday, 24 February 2006 02:40 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 24 February 2006 04:32 (twenty years ago)
Actually, they were still with A&M when they did that video. Why the hell do I know this???
I was actually revisiting their Down For the Count album, which came out right smack dab in the middle of their mid-80s free-fall. Aside from "Summertime Girls", which I actually like, it's pretty abysmal stuff. That band was great before they went all Aqua net on us...Contagious (the Geffen record) was shockingly awful.
― a. begrand (a begrand), Friday, 24 February 2006 05:22 (twenty years ago)
― George the Animal Steele, Friday, 24 February 2006 06:08 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 24 February 2006 12:56 (twenty years ago)
― Thomas Tallis (Tommy), Friday, 24 February 2006 14:07 (twenty years ago)
― Pashmina (Pashmina), Friday, 24 February 2006 14:08 (twenty years ago)
I'm not sure what "the first one" Thomas is referring to is, but Pentagram's *First Daze Too: The Vintage Collection* on Relapse is totally kicking my ass right now. See, I do too like real heavy metal!! But bizarrely I don't know whether I've ever listened to a Pentagram record before; just never got around to seeking any out I guess. Which, as I've long assumed and as this collection proves, is something to be ashamed of. Takes maybe four songs ("Under My Thumb", what?) for that first EP disc to kick in, but the rest of that, and the six songs I've gotten through so far on the second one, are stellar. Would be curious to hear from people who know this band more than I do how definitive they think this comp is. But either way, it's pretty amazing, as far as I can tell. (Haven't been able to find liner notes inside that say which songs came from which albums and which years, though. Did I just not read the booklet close enough?)
― xhuxk, Friday, 24 February 2006 14:28 (twenty years ago)
― xhuxk, Friday, 24 February 2006 14:48 (twenty years ago)
― ng-unit, Friday, 24 February 2006 15:28 (twenty years ago)
― pdf (Phil Freeman), Friday, 24 February 2006 15:30 (twenty years ago)
With Cliff dead, they had to steal from SOMEONE in bell-bottom jeans.
― scott seward (scott seward), Friday, 24 February 2006 15:34 (twenty years ago)
Speaking of Pentagram, we just brought into the store the Bedemon CD. It's on Black Widow (Italy) and it features original recordings from the '70s of this pre-Pentagram band. No promo but I'll probably pop open a copy to burn it into the store's in-store play archives...
― Brian O'Neill (NYCNative), Friday, 24 February 2006 15:48 (twenty years ago)
― ng-unit, Friday, 24 February 2006 16:01 (twenty years ago)
Well, I'd tell you but as usual I have no promo copy of this one. After I give the company a couple good reviews, they pay attention and cross me off their list. And you'll recall I put three Pentagram CDs on my P&J list around four years ago.
First edition of the band was significantly different in sound than later Peaceville act. The musicians were more rounded, the guitarist often employed a phaser, which was what ya did in the 70's to get the good tone. Jimmy Page prior to EVH and all that. There was a grand story told to me, by an aquaintance of Liebling's, that if Pentagram had been signed to Casablanca instead of Kiss...
It was a good story, I'll say that.
Anyway, the Peaceville records sound much more like Black Sabbath variations than the first band. They were Brit imports and well received but never made the band anything more than micro-micro cult. Liebling continued released records off and on -- Review Your Choices on Black Widow, an Italian label, is particularly good. Sub-Basement followed. These are distinguished by the wailing whistling tone of Joe Hasselvander on guitar, which adds to lugubrious nature of Liebling's metal singer/songwriter shtick.
I called him the heavy metal Cotton Mather once, and I think it's fairly appropriate if you listen to what he's going on about. It's deism.
The band on First Daze Here -- which was one I put in my Top Ten -- sampled from more of its contemporaries styles. There was a Captain Beyond flavor, plus a lot more from general early 70's hard rock bands, not just Black Sabbath. One thing has remained constant -- Liebling recycling songs and riffs over the decades. Always pretty successfully.
― George the Animal Steele, Friday, 24 February 2006 16:24 (twenty years ago)
http://www.villagevoice.com/specials/pazznjop/02/critic.php?criticid=461
I was Pentagram mad.
― George the Animal Steele, Friday, 24 February 2006 20:29 (twenty years ago)
― ng-unit, Friday, 24 February 2006 21:07 (twenty years ago)
― baby, disco is fuck (yournullfame), Friday, 24 February 2006 21:15 (twenty years ago)
George, there are none more metal. Everyone else, leave the hall...
― Brian O'Neill (NYCNative), Friday, 24 February 2006 21:20 (twenty years ago)
stacey evans, *a slender thread*, cdbaby californina pop-metal singer-songwriter rock; i definitely like some of it (especially "rollercoaster", absolute glam-metal roxette with a chorus about how a guy's moving too fast for her), and i kind of like the guitar sound (chunky and even sometimes boogiefied -- "a slender thread", which has a cabaret croon melody possibly ripped from "creep" by radiohead, ends with a pretty nifty guitar solo -- but often bordering on early psychedelic pop-rock, like i dunno, the beatles maybe?), and i like the europop undercurrent (e.g. vixen via abba in "letting them keep you") that courses through a lot of this. but soemething about the whole thing still screams "sincere and confessional folkie", which makes me wary. her voice is fine, i guess -- not as sandpaper as alanis or melissa etheridge, tougher than sheryl crow i guess but *probably* with less personality than at least two of those three, i'm not sure yet; maybe the personality will kick in later. plus the songs tend to get lost a lot, at least on first listen (maybe they'll kick in later too), and outwear their welcomes: best song is the shortest, and at 3:50 it's not that short. "machine" seems to want to sound like a machine, keeps going into these electro-rock parts and a robotic riff that reminds me of sly fox's "let's go all the way" of all things, but its melody is like "i am woman" crossed with benatar's "invincible" (maybe just because she keeps saying "invincible"?) crossed with some (i think) '80s new wave classic i can't put my finger on. last couple tracks seem to probably be the trippiest, but the trippiness is always balanced with commercial pop, which is a good thing. named as influences on her cdbaby page: bee gees, abba, fleetwood mac, eagles, def leppard, journey, electric light orchestra, olivia newton-john, ann wilson, karen carpenter. so, i dunno. i get the idea there might be interesting stuff going on here, but i need more time with it.
― xhuxk, Friday, 24 February 2006 21:24 (twenty years ago)
― xhuxk, Friday, 24 February 2006 21:27 (twenty years ago)
― pdf (Phil Freeman), Friday, 24 February 2006 21:38 (twenty years ago)
it was pretty good in a sub-weakling sort of way.
I must steal this line and secret it away for future use.
― George the Animal Steele, Friday, 24 February 2006 23:04 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 24 February 2006 23:36 (twenty years ago)
― George the Animal Steele, Saturday, 25 February 2006 00:03 (twenty years ago)
@ - not sure when they added NYC; perhaps there was another Brain Surgeons
@@ - documentary about dwellers of abandoned New York subway tunnels
― xhuxk, Saturday, 25 February 2006 00:17 (twenty years ago)
― Brian O'Neill (NYCNative), Saturday, 25 February 2006 00:29 (twenty years ago)
that's a great one!
― scott seward (scott seward), Saturday, 25 February 2006 00:33 (twenty years ago)
― scott seward (scott seward), Saturday, 25 February 2006 00:36 (twenty years ago)
I'm liking it.
Their drummer Martin is currently performing with Opeth, as it happens...
― a. begrand (a begrand), Saturday, 25 February 2006 01:00 (twenty years ago)
― scott seward (scott seward), Saturday, 25 February 2006 01:04 (twenty years ago)
― scott seward (scott seward), Saturday, 25 February 2006 01:05 (twenty years ago)
― scott seward (scott seward), Saturday, 25 February 2006 01:06 (twenty years ago)
― pdf (Phil Freeman), Saturday, 25 February 2006 01:44 (twenty years ago)
― adam (adam), Saturday, 25 February 2006 02:09 (twenty years ago)
Yeah, I should have clarified. Axenrot's filling in for Lopez.
― a. begrand (a begrand), Saturday, 25 February 2006 04:09 (twenty years ago)
I actually spent time last nite listening to music on the internet! can you imagine? And I had my mind completely blown by *Benighted Leams*!!! They are officially my new favorite band.
― scott seward (scott seward), Saturday, 25 February 2006 13:21 (twenty years ago)
― Brian O'Neill (NYCNative), Saturday, 25 February 2006 13:40 (twenty years ago)
Dude has his own label:
http://www.supernalmusic.com/
i learn, like, one new thing a day.
― scott seward (scott seward), Saturday, 25 February 2006 13:48 (twenty years ago)
― Brian O'Neill (NYCNative), Saturday, 25 February 2006 14:05 (twenty years ago)
― scott seward (scott seward), Saturday, 25 February 2006 14:17 (twenty years ago)
"...we are engaged in a culture war, supplying a positive alternative to the degenerate, superficial, spiritually-destructive mainstream pop culture of today...
[Picture this guy supplying dialog for the new VW commercial, where the German overseer mocks the idiot American after destroying his lame car by crushing, catapulting, etc. "Snap! Black metal engineering, ja!"]
"HATE FOREST's art is based upon the Aryan/Slavonic mythology, Nietzschean philosophy, and the ideology of elitism. Now HATE FOREST includes four persons. Every subhuman buying HATE FOREST releases buys a weapon against himself.
"...In the Summer of 1997, however, Davies contacted Supernal Music following an advertisement in a mail order catalogue, where the label expressed interest in bands inspired by Astronomical, Astrophysical, and Cosmological subjects. Supernal Music's reaction was one of comprehension and disbelief, which resulted in a record deal. "Noctilucent Threnody" is the first of a planned ten albums, most of the material for which has already been recorded. The latter will not see the light under Supernal Music, however.
"...the tirelessly prolific Davies recorded several hours of material (including a titanic 78-minute piece), samples of which were sent to a wide variety of record labels...
It beats joining the Army and getting shipped to Iraq, I'll say that.
― George the Animal Steele, Saturday, 25 February 2006 16:22 (twenty years ago)
― xhuxk, Saturday, 25 February 2006 17:24 (twenty years ago)
I'm still digesting the comprehension and disbelief of Supernal Records.
So why don't we hear anything about the band AC/DC's Alberts are flogging downunder, like Dallas Crane?
― George the Animal Steele, Saturday, 25 February 2006 18:41 (twenty years ago)
― xhuxk, Saturday, 25 February 2006 20:19 (twenty years ago)
Now, maybe you can explain this to me. It's a bit off topic, but a story in today's LA Times on the Hold Steady pushed all my buttons. Perfect example of everything I detest in pop music journalism, first of all being, when you read it -- you don't believe a single thing that's claimed in it. Second, it's overwritten to make the subject look intellectual. The Hold Steady guy is an intellectual? Even if you were an intellectual and you're in a rock band, why on earth would you want to appear as one in a newspaper article? It just makes you seem asinine.
Here's some spectacular quotes, of many:
"For a fast drive to the dark end of Thunder Road, hitch a ride on the Hold Steady's [blah-blah], an album that made a big noise on the best-of-2005 lists, including an eye-opening finish in the prestigious Village Voice's critics' poll. [Did Cromelin, who wrote this, vote for it?]
"...the group's growth is also measured by such attention as the profile on NPR's 'All Things Considered' late last year, complete with a rigorous annotation of the album's pop, literary and cultural references."
[Now I'm really ballistic. Being cited on NPR, for me anyway, is most assuredly proof that there is no rock to be found. If you were in a rock band you -wouldn't- want to be on NPR because it would mean NO SALES. I say it from experience. Having been on NPR several times, and regular talk radio, NPR HAS NO LISTENERS!! Well it does, but not compared to regular radio and the audience, advertised as smart and upscale, are really as limp, sissy and passive a bunch as can be found, humanoids who listen to it as air-freshener in the upper middle class abode. So why does this stupid meme keep circulating that it's good to be in a pop rock band that gets special attention on NPR? It means you're struggling to sell less than 20,000 copies.]
"[Springsteen] used a lot of words, [main guy] Finn said of Springsteen ... "But also his literary take on what I call the American teenage experience..."
"...a full blown classic rock sound drawn proudly from the likes of Bob Seger, Aerosmith, the E Street Band and Cheap Trick." [How do you get the E Street Band and Cheap Trick into the same band? Yeah right. LIAR! LIAR Pants on fire!]
[Then we get to the punchline. This is good because it has something to with Lifter Puller.]
"My wife took me to see 'The Last Waltz'"... [Oh, got to get the Band in there, too, so we can be touching stones with Manuel and Danko, like the Drive-By Truckers.]
"It struck Finn and Kubler as an invigorating alternative to what they say as the sterility of the disco-punk sound that was so big in New York..." [F---in' Ay!]
"People started showing up," the bespectacled Finn said of the group's early performances." [Well, we wouldn't be writing this awful piece of shit now, would we, if they didn't.]
"...all the music sounded sterile to us...I think the music public was sick of it, too. And people with loud guitars, solos, loose playing? I think it was fun for people to hear that, it reminded them of something..." [It reminds me of people who should remember the aphorism: Better to be thought a fool than open one's mouth and remove all doubt.]
"On stage at the Avalon, Finn was no longer the bespectacled intellectual...he seemed to be taken over by a Joe Cocker palsy..."
"We've gotten a lot of fans off of being on NPR [I don't believe you unless by 'fan' you mean someone who has heard your name but has no intention of buying a record]. 'Cause they grew up rock 'n' roll fans, people who have been Aerosmith fans for thirty years. [Aerosmith fans listen to NPR? By accident? This made no sense at all, it not only unbelievable, it was demented.]
― George the Animal Steele, Saturday, 25 February 2006 20:53 (twenty years ago)
― scott seward (scott seward), Saturday, 25 February 2006 21:24 (twenty years ago)
― George the Animal Steele, Saturday, 25 February 2006 21:47 (twenty years ago)
Still, that was last year.
Big City Rock are neither any good nor metal. Amor Fati's new one ditto, though I actually liked an album by him enough to put it in my top ten back in 1987 or so, when he just seemed like this insane New Jersey guy making homemade objects of noise and beauty, and stitching together silly collages of surgery and mass murder on his album sleeves. All of which sounds pretentious as fuck, but yeah, so was he. The album I liked back then was called *Body W/O Organs,* but he also put out a couple EPs (some under the name Will to Live I think) that I reviewed favorably in *Creem Metal*. So their sound must have had *something* to do with metal, though "art noise" is probably the real category, and they've all been long gone from my house for eons. If I heard them now, no idea if I'd like them. But his new one is just synthy singer-songwriter swill done in a flat voice, a total drag.
I kind of like the Darsombra album. Neurisis types from Baltimore, and if that makes you wince feel free. But it's a nice thick lovely wall of noizak, with exursions into jangly ringing folk drone and industrial space dub and 1980 Pere Ubu babbling breaking up the thrash in the way Neurosis and Isis never have. Worth checking out if you can bear such things.
― xhuxk, Saturday, 25 February 2006 23:24 (twenty years ago)
Well, I didn't buy it. Their sales don't match any form of classic rock at 17,000, so I'm in no way convinced they're touching any of that audience, NPR or not. So if it's Thin Lizzy is it Live & Dangerous or pre-Fighting? In any case, I'm not going to find out about it on my dime. Pic had him rocking out in his spectacles, quote notwithstanding. He looked more like the guy in Weezer, not Joe Cocker.
― George the Animal Steele, Saturday, 25 February 2006 23:34 (twenty years ago)
― Harpal (harpal), Sunday, 26 February 2006 00:08 (twenty years ago)
― scott seward (scott seward), Sunday, 26 February 2006 01:08 (twenty years ago)
that lifter puller nonsense has GOT to be the most rockcritiky stuff i have fallen for in a long time. it reeks of rockcritikyness. yet, i fell for it. it took me a while too. i hated it at first.
― scott seward (scott seward), Sunday, 26 February 2006 01:11 (twenty years ago)
― scott seward (scott seward), Sunday, 26 February 2006 01:17 (twenty years ago)
i have no desire to listen to destroyer, though maybe i will eventually out of obligation. my daughter saw them in philly and found them amusing, though she hated neko case. (she also saw morningwood last week and only liked their theme song, and thought the singer was idiotic and embarrassing, esp. when she did her moronic take your clothes off shtick.)
― xhuxk, Sunday, 26 February 2006 01:25 (twenty years ago)
― scott seward (scott seward), Sunday, 26 February 2006 01:50 (twenty years ago)
― scott seward (scott seward), Sunday, 26 February 2006 01:52 (twenty years ago)
― xhuxk, Sunday, 26 February 2006 01:55 (twenty years ago)
― xhuxk, Sunday, 26 February 2006 02:01 (twenty years ago)
For whatever it's worth, Craig Finn probably knows this too. Though there *was* at least one Catholic boarding school where I grew up - St. Mary''s Prep/Sts. Cyril and Methodius Seminary, Orchard Lake, MI, right across the street from Our Lady of Refuge, where I went through eighth grade. St. Mary's definitely had a high school, and the students slept there. Also, the Polish pope visited there once, back before he was pope. I even interviewed the priest who was the chancellor of the school about it, while writing for a suburban weekly.
Er, hopefully somebody will return this derailed thread to metal soon...
― xhuxk, Sunday, 26 February 2006 02:12 (twenty years ago)
I'm through on the Hold Steady shit. The LA Times piece was so awful because it was what you called so archly sincere "rock criticky." That always makes me want to barf. This is so so good for you... and Finally, intellectuals doing indie altie classic rock, not like all those unbearable old cretins who did classic rock....
AntiProduct's Made in USA came via download from Australia where it's repped by AC/DC's Albert Productions. The band is the work of the guitar player from Life Sex & Death, a group I've ranted about on and off for having invented the rarely mined pop metal with a dancing homeless man as a singer genre. It still often sounds like LSD except without the dancing homeless man with the great voice. In place of him, the guitarist with a fair voice and girl backing singers who sound like Bratz, ie, teenpop.
Wall o' guitar in glam rock 80's style. First three tunes come at you like bulldozers and sound like their titles: "Thank God I'm Right," "Turnin' Me On," and "Goin' Where the Action Is" which makes me think Kim Fowley and southern California. Then for "If I was Orson Welles" it gets heavy, complicated and claustrophobic. "Something Good" brings it all back as the tune for the album with good hook and some Queen vocal stacking by girls instead of guys plus "Girls Who Wanna Be Boys" and "The Rules We Rock & Roll By." Reminds me sometimes of early Sparks if early Sparks had REALLY CRUSHING GUITAR and not the helium voice. Which may not be Sparks. Ends with "My Satin," backing goyl singers doing some kind of Bertolt Brecht/Kurt Weill Deutschland cabaret spoof which turns into a long song done on kazoo.
This band is from Britain, I am told, where the LSD guy fled to after flopping here.
And still no one has provided information on Dallas Crane so I guess I'm going to have to take one for the team and find out myself.
― George the Animal Steele, Sunday, 26 February 2006 02:16 (twenty years ago)
why is it you are attracted to it? cos of the name?
― rizzx (Rizz), Sunday, 26 February 2006 02:21 (twenty years ago)
And on that note, did anybody else ever wind up hearing that crappy Opus Dai CD yet?
* -- Oops, George got there already!
― xhuxk, Sunday, 26 February 2006 02:22 (twenty years ago)
aaah tell me what you think of it soon as you've heard it. I dig Sapthuran's raw style a lot but he could've cut the acoustic crap, it doesn't improve the dynamics of his side
leviathan's part is awesome, it sounds so HUGE
― rizzx (Rizz), Sunday, 26 February 2006 02:23 (twenty years ago)
― rizzx (Rizz), Sunday, 26 February 2006 02:28 (twenty years ago)
no, that's not it. unlike chuck, i like wordy lit-rock (aside from lftr plr and hld stdy). and i heard the dude had a way with words.
and to get back to metal, i second my heartfelt liking of the latest Craft album and the Urgehal reissue *Through Thick Fog Till Death*. Both are thick & nasty with unexpected rock moves. but, you know, the rock moves are subtle.
― scott seward (scott seward), Sunday, 26 February 2006 02:41 (twenty years ago)
Philly EDGE, Suburban Philadelphia’salternative weekly entertainment andarts tabloid is distributed at more than700 locations in Bucks, Montgomery,Mercer and Burlington Counties.
Pick up a copy of this week’s issue ata newsstand, bar, nightclub, hotel orconvenience store near you.
― scott seward (scott seward), Sunday, 26 February 2006 02:45 (twenty years ago)
― scott seward (scott seward), Sunday, 26 February 2006 02:46 (twenty years ago)
― xhuxk, Sunday, 26 February 2006 02:48 (twenty years ago)
But anyway. yeah: metalmetalmetalmetal
― xhuxk, Sunday, 26 February 2006 02:50 (twenty years ago)
http://www.businessownersideacafe.com/genx/cityvibz.html
I love metal.
― scott seward (scott seward), Sunday, 26 February 2006 02:54 (twenty years ago)
― scott seward (scott seward), Sunday, 26 February 2006 03:04 (twenty years ago)
― scott seward (scott seward), Sunday, 26 February 2006 03:05 (twenty years ago)
he defintaly has a way with words and although i'm from holland it's mostly this slight cynical tone of his i'm attracted to, not the yelping perse but the words which he yelps
if that makes any sense, god í'm just sitting here with a bottle of almost empty jagermeister
xpost- i hope thats you scott. i so hope thats you
― rizzx (Rizz), Sunday, 26 February 2006 03:06 (twenty years ago)
http://www.dutchtoenglish.com/scott%20001.jpg
― scott seward (scott seward), Sunday, 26 February 2006 03:07 (twenty years ago)
― scott seward (scott seward), Sunday, 26 February 2006 03:08 (twenty years ago)
― rizzx (Rizz), Sunday, 26 February 2006 03:09 (twenty years ago)
http://calendar.walkerart.org/event.wac?id=2697
― scott seward (scott seward), Sunday, 26 February 2006 03:42 (twenty years ago)
― scott seward (scott seward), Sunday, 26 February 2006 03:43 (twenty years ago)
― a. begrand (a begrand), Sunday, 26 February 2006 09:35 (twenty years ago)
― Brian O'Neill (NYCNative), Sunday, 26 February 2006 19:03 (twenty years ago)
Martin's funk thread
― xhuxk, Sunday, 26 February 2006 19:11 (twenty years ago)
― xhuxk, Sunday, 26 February 2006 19:15 (twenty years ago)
― Ned Raggett (Ned), Sunday, 26 February 2006 19:26 (twenty years ago)
Looking forward to this album. "Our Truth" has grown on me.
― a. begrand (a begrand), Sunday, 26 February 2006 22:41 (twenty years ago)
Quote:
"One spin of the four song EP, and you'll be feeling at least the flutter of an impulse to make out with strangers. Two, and you'll want to take off your clothes. In public.
"Things were better in the 70's," [says a Wolfmother dude who wasn't alive then.] Cars looked better. Interior design looked better. A lot of artwork was more progressive...we're in a time of technical efficiency and modern living but things aren't aesthetically improving."
"Listening to Wolfmother, it seems that music is an act of liberation as much as a means of expression."
Led Zeppelin, Black Sabbath, the White Stripes and Trans Am get mentioned.
"Now riffs are what the group's all about. It was riffs that prompted a near riot at their first live performance in 2004..."
"It isn't just the music that's getting the group so much attention. It's their authenticity, their vibe, their look. While in LA...the band sat for an interview with The Times and an appearance on the MTV show 'You Hear It First.'...For all of it Stockdale wore ... a Pink Floyd tee...Heskett was in a black motorcycle jacket, Ross a battered velvet smoking coat."
All right! T-shirt and leather jacket confer upon you authenticity!
====In other news from Australia, I gave a listen to the Dallas Crane EP, Can't Work You Out. Handled by Albert Productions, I expected them to rock and they did. Enough to make it a keeper but not as much as I had hopes for. "No Through Street" was the loudest riffiest cut but all six on the thing worked OK. Has a mid-70's hard Brit rock thing going on.
― George the Animal Steele, Sunday, 26 February 2006 22:42 (twenty years ago)
I still haven't heard Wolfmother.
― Last Of The Famous International Pfunkboys (Kerr), Sunday, 26 February 2006 22:51 (twenty years ago)
― a. begrand (a begrand), Monday, 27 February 2006 04:53 (twenty years ago)
The vocals are all a lot cleaner than on any LC disc, even the male parts; the "beast" (of beauty & the beast tag-team vocals) has been tamed. I can tell that detractors will say that they dumbed it all down (i.e. Evanescence who get a lot of flack from the Euro-philes) but to me it is the record the band had to make and is a good step after Comalies.
The disc does not crunch much (which is a little disheartening) and the keyboards and electronic-enhanced drums dominate the mix but Christine's vocals bring an organic quality to the material despite this. Yeah, I'm smitten by her voice but that's nothing new.
"Fragments Of Faith" borders on mook-rock, which isn't so good, escept the gothic keyboards makes it sound like older Sisters, which is good.
"Closer" sounds like it could be off the last Thearer Of Tragedy record that I - almost single-handedly - loved (I think xhuxk and his daughter agreed with me!) so of course I like it. It's the most accessible cut here by far but not singles material, I don't think, since it seems like a departure from the "Gothic Metal" picture the label will doubtlessly present. I'd like to hear Avril Levigne cover it. Seriously.
"Without The Fear" is beautiful, even more so than the acoustic-like ballad that is "Within Me," mainly because the latter has the dude leading the vocals.
Some filler but a solid disc nonetheless. I still wonder how the band will do with Rob Zombie's audience...
― Brian O'Neill (NYCNative), Monday, 27 February 2006 15:44 (twenty years ago)
There's a lot of thumping pop boogie and slashing guitar on the record. If you're into the new heavy metal thing on this thread you'll want to stay away, but it rocks. And the Beatles-ly harmonies pervade it. TNT's All the Way to the Sun -- it's pop single parts, anyway -- are in the same place Badfinger was on this record. "Rock and Roll Contract" is their depressing lifestory in 5:30. Everyone knows it. Usurious contract aggravates Pete Ham's depression so much he hangs himself. Because it's about death and financial ruin, they kind of made it into boogie progopera. "No More" is the best tune on the record (R&R Contract is second) and it dwells on the same story again, the remnants of the band basting in their failure and still pretty angry about it.
― George 'the Animal' Steele, Monday, 27 February 2006 17:17 (twenty years ago)
― George 'the Animal' Steele, Monday, 27 February 2006 17:18 (twenty years ago)
New Brain Surgeons (oops, Brain Surgeons NYC -- featuring Al Bouchard and Deborah Frost, in case you're not aware) album is good, as is pretty much every album I've heard by them. Specifics someday, I hope.
― xhuxk, Monday, 27 February 2006 18:07 (twenty years ago)
well their albums will be re-issued
via Blabbermouth.Nethttp://tinyurl.com/fmvsx
Escapi Records will re-release all five albums from the acclaimed band WARRIOR SOUL. On March 14,
― DJ Martian (djmartian), Monday, 27 February 2006 19:07 (twenty years ago)
Noam Chomsky and Howard Zinn were right, too, but they manage to convey without making the process itself a chore to endure. Anyway, I reviewed the first two albums a long time ago. It wasn't pretty. Maybe I'd think different now. There's a Best of under some title floating around, too, which is surely the work of an eternal optimist, bless 'em.
― George 'the Animal' Steele, Monday, 27 February 2006 20:13 (twenty years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Monday, 27 February 2006 20:18 (twenty years ago)
― pdf (Phil Freeman), Monday, 27 February 2006 20:23 (twenty years ago)
― George 'the Animal' Steele, Monday, 27 February 2006 20:47 (twenty years ago)
Yeah, and I remember groaning upon hearing that declaration. That band never did anything for me at all.
― a. begrand (a begrand), Monday, 27 February 2006 22:05 (twenty years ago)
― latebloomer: where dignity goes to die (latebloomer), Monday, 27 February 2006 22:13 (twenty years ago)
Now the meme is expanded to include every hard rock/metal band that doesn't sing about swords/dragons/satan/dead things/diseases/witches/warlocks. It also means the particular metal band the critic likes for the duration of the review, not like all the other hard rock/metal bands the proles and lesser among the polity like.
― George 'the Animal' Steele, Monday, 27 February 2006 22:24 (twenty years ago)
Heh.
Queensryche owned that tag from 1984 to 1988.
― a. begrand (a begrand), Monday, 27 February 2006 22:25 (twenty years ago)
http://www.google.com/search?q=%22thinking+man%27s+metal%22&hl=en&lr=&start=30&sa=N
Results 31 - 40 of about 1,900 for "thinking man's metal".
Thinking Man's Metal, a genre made up of such bands as Metallica, Iron Maiden, Dream Theater, ... Thinking Man's Metal albums can usually be put on repeat,
Like jazz and prog rock, Progressive Metal inspires its share of snobbery, and the mantle of "thinking man's metal" has sometimes been used dismissively on ...
But if Early Man's throwback style isn't as grave or artsy as that of some of the underground "thinking man's metal" acts that've been getting loads of ... sfweekly.com
The first results of this was a band like Metallica, who worked their way from indie obscurity to become both the thinking man's metal band...[ha-ha, Salon.com, writing about metal]
The band has, after all, been branded "thinking man's metal." We aren't sure what that means but judging by the buzz Isis has sparked with its Ipecac
"Tales from the Soul" is thinking man's metal that aims for the heart as well as the head.
Long dubbed "the thinking man's metal band," Queensryche have always been difficult to classify; somewhere between Iron Maiden and Pink Floyd.
"Technical, intense and truly progressive, this album marks the new era of thinking man's metal. Spiral Architect formed in 1993 intent on building upon a .
While most heavy metal bands of the '80s favored either glam or thrash, Dio specialized in "thinking man's metal." Dio was one of the first hard ...
Title description at Aquarius, the thinking non-thinking man's record store... this limited 12" is a split release on both NYC based post rock label Temprorary Residence, and now-LA based thinking man's metal label Hydra Head. ...
Thinking man's metal. Who thought up that line? Oh joy. ... Seriously, even this so called 'thinking man's metal' bit is getting a bit old. ...
SOULSCAR are definite thinking-man's Metal, weaving a sonic tapestry that is at once a hammer-shock to the psyche, yet at the same time, an emotional musical ...
― George 'the Animal' Steele, Monday, 27 February 2006 22:34 (twenty years ago)
― pdf (Phil Freeman), Monday, 27 February 2006 22:38 (twenty years ago)
Skip Rubies and go for Your Blues first. It's a better album and makes for an easier "in." Plus you don't have to feel like a lemming buying Rubies. Most of what's been written about Destroyer (on boards and in the press) is bullshit.
PS Buried Inside - good or no?
― Edward III (edward iii), Monday, 27 February 2006 22:41 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Monday, 27 February 2006 22:43 (twenty years ago)
Used albums are the scorned lovers of the retail universe.
At one point, that copy of Billy Idol's "Rebel Yell" was the most important thing in your life -- until you spent less and less time together, and one day it was heartlessly replaced with something in the thinking-man's-metal genre. (This is similar to the plot of "Toy Story," except with a lot less Randy Newman and a lot more System of a Down.)
... Have you ever asked yourself why there are at least 25 used copies of R.E.M.'s "New Adventures in Hi-Fi" at every record store, and finding a copy of "Toto IV" or Ratt's "Out of the Cellar" is next to impossible?
... If you could trace the previous owners of every album you own, it would be something like looking at your past lives. Take the time to interview the previous owners of every used record in your collection, and you will find hundreds of mirror images of yourself.
The last five records you've bought and sold reveal more information about you than any consumer database or Patriot Act spying tools can gather. If somebody ever figures out how to combine the ownership history of a used record and a matchmaking service, they will retire in a Getty-like state of luxury.
― George 'the Animal' Steele, Monday, 27 February 2006 22:51 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Monday, 27 February 2006 22:54 (twenty years ago)
Half plain-jane kiddiecore, half really smart melodic metal. Enough melodies to set them apart from the rest of the crowd and warrant a recommendation. Marta's keyboards enhance the music greatly at times.
― a. begrand (a begrand), Monday, 27 February 2006 23:58 (twenty years ago)
Buried Inside's Chronoclast album is one of the better Canadian metal releases of recent years...
― a. begrand (a begrand), Monday, 27 February 2006 23:59 (twenty years ago)
― George 'the Animal' Steele, Tuesday, 28 February 2006 09:24 (twenty years ago)
― Brian O'Neill (NYCNative), Tuesday, 28 February 2006 14:02 (twenty years ago)
Which reminds me that one of the "thinking man's metal bands" from the early '90s pre-grunge/post-hair era who I actually didn't mind at the time were I Napoleon. I gave them an okay review in Spin, I think, but god rid of the album years ago regardless, and I never heard of them ever putting out another one. Anybody remember them?
The only Count Bishops album I own, George, is their self-titled 1977 debut (though weren't they just called the Bishops before that? Or was that later?) from pub-metal label Chiswick (see also: Motorhead when Motorhead were the best Motorhead would ever be). Totally brutal r&b punk album -- nobody has ever done a version of "Somebody's Gonna Get Their Head Kicked In Tonite" that kicks more heads in -- not Fleetwood Mac, not the Rezillos, nobody. I wish I had more by them.
― xhuxk, Tuesday, 28 February 2006 14:56 (twenty years ago)
― pdf (Phil Freeman), Tuesday, 28 February 2006 16:16 (twenty years ago)
― George 'the Animal' Steele, Tuesday, 28 February 2006 17:08 (twenty years ago)
― pdf (Phil Freeman), Tuesday, 28 February 2006 17:52 (twenty years ago)
aren't we all? they're kind of off-brand, but you might want to check out blues creation demon and eleven children (japanese) or firebirds light my fire (probably californian).
― baby, disco is fuck (yournullfame), Wednesday, 1 March 2006 00:10 (twenty years ago)
Billboard also says Tusk's debut album *Get Ready* is being reissued. I think I never heard that one, but I liked their *Tree of No Return* from 2003 better any Pelican record I've heard. (I think I've heard three of those. Tusk includes three of four Pelicans, I believe.)
― xhuxk, Wednesday, 1 March 2006 00:33 (twenty years ago)
Billboard behind the speed of electrons. Error! Is already reissued. It's on eMusic and looks like a 30-minute mixture of blurting noise/spastic art metalcore and blurting noise to me, brought up to length by padding with live tracks. Mostly 1 and 2 minute tracks, some 40 second things.
― George 'the Animal' Steele, Wednesday, 1 March 2006 01:40 (twenty years ago)
― George 'the Animal' Steele, Wednesday, 1 March 2006 03:00 (twenty years ago)
― Drew Daniel (Drew Daniel), Wednesday, 1 March 2006 03:30 (twenty years ago)
― Mr _Deeds (Mr_Deeds), Thursday, 2 March 2006 06:26 (twenty years ago)
In the meantime, I've had a chance to listen to The Tokyo Dragons' Give Me The Fear. Purist hard rock/metal fans (70's/80's/some NWBHM) may want to inspect. At least fair to good -- can't tell more -- only gave it once-twice through. Supposedly unsuccesful rivals to The Darkness which puts them in the same ballpark at the Glitterati.Don't know anymore about them. Good, bad, indifferent?
And can't wait to listen to Josefus' reunion gig, recorded live in 2004 on Halloween. For those who forget -- Josefus was a late-60's Texas band, allegedly liked by ZZ Top, who made a couple records encapsulated in the Deadman reissues. Of course, while lots of the usual perps turned out for Deadman, like me, this seems to have gone unnoticed.
― George 'the Animal' Steele, Thursday, 2 March 2006 17:49 (twenty years ago)
that new Witchery album kicks ass as well, uncomprimising and groovay
― rizzx (Rizz), Thursday, 2 March 2006 21:11 (twenty years ago)
― pdf (Phil Freeman), Thursday, 2 March 2006 21:18 (twenty years ago)
I'm finding it next to impossible to dislike anything coming from The End in recent months...if there's one label that caters to what I like most in metal, it's them.
Oh, and I officially love the new Gathering album.
― a. begrand (a begrand), Thursday, 2 March 2006 22:01 (twenty years ago)
Yeah, maybe you should wait on that, Phil. Josefus is no way near as common a spin for me as the Groundhogs. I'll let you know how the live one sounds.
― George 'the Animal' Steele, Thursday, 2 March 2006 22:07 (twenty years ago)
Boooooo! i shoulda known you wouldn't like groundhogs though. you hate so much stuff that i love. if you can't find anything worthwhile in t.s.'s guitar, i don't know what to say. i consider split one of the GREAT hard rock albums of that era. did you play it loud enough?
chuck, that brain surgeons record is great! very entertaining.
― scott seward (scott seward), Thursday, 2 March 2006 22:09 (twenty years ago)
― George 'the Animal' Steele, Thursday, 2 March 2006 23:41 (twenty years ago)
― Brian O'Neill (NYCNative), Thursday, 2 March 2006 23:47 (twenty years ago)
― pdf (Phil Freeman), Friday, 3 March 2006 00:41 (twenty years ago)
Speaking of which, anyone hear the III disc yet? I understand it has metal appeal...
― Brian O'Neill (NYCNative), Friday, 3 March 2006 00:48 (twenty years ago)
― pdf (Phil Freeman), Friday, 3 March 2006 01:20 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 3 March 2006 01:38 (twenty years ago)
http://www.villagevoice.com/music/0610,smith,72378,22.html
― xhuxk, Friday, 3 March 2006 01:45 (twenty years ago)
If you mean Hank III, I wouldn't go anywhere near that far. First side is old timey dusty and dirty sitting by the cracker barrel with your teef falling out country in which the same song sound like it's played two or three times. Second disc is about precisely as Phil described. Some like it, some hate it. I panned it, mostly because I thought it bored me off the couch and into switching it off. Opinions averaged out to indifferent on Rolling Country as I recall.
Back to the Tokyo Dragons whose Give Me the Fear is way more bazooka rock than I originally let in. (Had been totally sidetracked by the glam pop magnificence of Jesus H. Christ and the Four Horsemen.) Tokyo Dragons album title refers to raver about singer being intimidated by a good-looking girl. He wants her to give 'im the fear more, more, more. Lots of jubilant gang vocals and shit hot slashing riffs set to goin' out on the street to have some fun metal.Corny but really effective.
― George 'the Animal' Steele, Friday, 3 March 2006 01:45 (twenty years ago)
― George 'the Animal' Steele, Friday, 3 March 2006 01:49 (twenty years ago)
― scott seward (scott seward), Friday, 3 March 2006 01:50 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 3 March 2006 01:51 (twenty years ago)
― scott seward (scott seward), Friday, 3 March 2006 01:52 (twenty years ago)
― scott seward (scott seward), Friday, 3 March 2006 01:55 (twenty years ago)
― adam (adam), Friday, 3 March 2006 02:18 (twenty years ago)
― scott seward (scott seward), Friday, 3 March 2006 02:22 (twenty years ago)
Following in the footsteps of Entombed > Hellacopters... All those Scandinavian metal-types love the rawk bands. They all play shows with Turbonegro and the like. I wonder if that shit would fly here... But I can't see Morbid Angel touring with Nebula in the midwest...
― Brian O'Neill (NYCNative), Friday, 3 March 2006 02:25 (twenty years ago)
He produced that Transistor Transistor record, right? I like that a lot. What else has he done? Google is less than helpful.
― adam (adam), Friday, 3 March 2006 02:30 (twenty years ago)
― scott seward (scott seward), Friday, 3 March 2006 03:06 (twenty years ago)
― scott seward (scott seward), Friday, 3 March 2006 03:10 (twenty years ago)
― scott seward (scott seward), Friday, 3 March 2006 03:13 (twenty years ago)
― adam (adam), Friday, 3 March 2006 03:17 (twenty years ago)
xposted to skot: seconded. i broke down and bought rubies and your blues before taking a trip to boston this weekend. a friend of mine believes he's pulling a kieslowski and if you take notorious [white] lightning, you've got blue, white, red (albeit not in that order.)bejar is the best part of the new pornographers.
― blackmail (blackmail.is.my.life), Friday, 3 March 2006 03:35 (twenty years ago)
― scott seward (scott seward), Friday, 3 March 2006 03:38 (twenty years ago)
anyway. now i'm pissed off that i got rid of my copy of that tokyo dragons album from last year. i gave it a cursory listen when i got it, didn't hear much (probably because i wasn't paying close enough attention, who knows), mentioned it (i think) on the 2005 metal thread, kept it for a while longer, and when nobody else mentioned it i must have stuck it in a box. who knows, maybe it's in one of the 15 boxes stacked up in my office (no exagerration) which i need to haul off the princeton record exchange one of these days (preferably soon.)
i got that chuck norris experiment CD a couple days ago, scott, and figured it would be as rote and ignorable as gluecifer or the hellacpters, so i stuck it in a box too, and this morning i can't find it. i'll look some more. had i noticed the tiamat connection, i may have put it in my "to play" pile, but i probably wasn't reading press releases very closely that day. (mainly what it made me think of was that cordelia was telling me there's some fad for dumb chuck norris jokes at her high school in perkasie right now, and she had no idea who chuck norris was. even if she did, the jokes weren't funny.)
this morning i was really liking the very homemade looking CD by some tough-lady-led hard rock band called shiny mama. they've got some 1994 in them, i think. also some '70s aerosmith. i figure they might have some connection to cdbaby, but cdbaby seems to be down right now. album came out in 2005, nine songs, it's called *what comes around goes around*; gal on the back looks kinda like the rapper eve! they recorded the thing in new york, which might mean they've local.
got reissues of cheap trick's *dream police* and *all shook up* (their most underrated albums) in the mail yesterday; the latter includes four songs from their old 10-inch epic nu-disck EP *found all the parts,* which i don't remember being very good, but maybe i was wrong because covering "day tripper" seemed corny to me at the time. anyway, i'm looking forward to putting both of these CDs on.
did anybody notice that track #6 of the first disc of that new pentagram album turns blatantly into "tropical heat wave" (by irving berlin, i think)? better than the james white and the blacks version.
― xhuxk, Friday, 3 March 2006 14:45 (twenty years ago)
― Je4nne Æ’urÂ¥ (Je4nne Fury), Friday, 3 March 2006 15:09 (twenty years ago)
>*all shook up* (their most underrated album)<
this is what i meant. i'm not sure if i think *dream police* is more underrated than *one on one* or not (though it's definitely better.)
― xhuxk, Friday, 3 March 2006 15:29 (twenty years ago)
― scott seward (scott seward), Friday, 3 March 2006 16:36 (twenty years ago)
Now here's some more for you: the Smooth Sax Tributes to Cher, Phil Collins and Madonna. Saxaphones are made of metal, very shiny metal, so I'm in on a technicality.
Didn't listen to Josefus yet but did listen to the Brain Surgeons and Ross the Boss makes a difference. Now the riffs come at you faster and louder and when Albert Bouchard sings it sounds more like the old 70's vim from BOC onstage. "Rocket Science," "Plague of Lies," "1864" and "Swansong" are the best tunes so far. "1864" really sticks out. It had a real aggressive Ted Nugent vibe.
And the best songs on Tokyo Dragons' Give Me The Fear are "Come On Baby," from which the album title stems, "Johnny Don't Wanna Ride," either a street racing or motorcycle tune, and "Chasin' the Night" which is more careering riff and fun metal.
And still I know nothing about Dallas Crane, allegedly a big deal in Melbourne, who have a few records, of which I have heard one EP that wasn't bad.
― George 'the Animal' Steele, Friday, 3 March 2006 17:29 (twenty years ago)
― Ned Raggett (Ned), Friday, 3 March 2006 17:35 (twenty years ago)
I know the feeling. I've found that listening to metal - or anything really obnoxious and abrasive - really loudly works for me. I often go with the classics... Reigning Blood for instance... but pick something that works for you. When eardrums bleed the rest doesn't matter.
― Brian O'Neill (NYCNative), Friday, 3 March 2006 18:35 (twenty years ago)
― George 'the Animal' Steele, Friday, 3 March 2006 18:54 (twenty years ago)
(sorry, resume metal discussion)
― Edward III (edward iii), Friday, 3 March 2006 20:36 (twenty years ago)
Slayer will be touring with Mastodon, Lamb of God and Children of Bodom this summer.
― pdf (Phil Freeman), Friday, 3 March 2006 21:59 (twenty years ago)
― George 'the Animal' Steele, Saturday, 4 March 2006 04:06 (twenty years ago)
I approve of this tour. All three of the newish bands I like to varying degrees and the young'uns they bring in will get to see the mighty Slayer. The crusty geezers who go for Slayer will possibly realize that some of the newer bands have merits. Plus the show will not involve sitting outside for 12 hours (I assume).
― Brian O'Neill (NYCNative), Saturday, 4 March 2006 06:47 (twenty years ago)
Absolutely. Slayer has promised a roof over the audience's heads at all stops.
So the new Summoning album (on Napalm) has a song sung in Orcish, which the label/band claims is the first ever. The Lord Of The Rings books have been out for about 50 years at this point, and no one has ever sung in Orcish before. One would think the bandmembers would have spotted the flashing neon hint, but they didn't.
Also got the new Lair of the Minotaur album, which features Pelican's guitarist (or maybe it's their drummer) playing drums. It's not bad in a Mastodon/power trio way. The first album by Mord, a new two-man black metal act from Norway, is also acceptable.
― pdf (Phil Freeman), Saturday, 4 March 2006 13:48 (twenty years ago)
Whatever happened to writing about what you know, like getting VD, stealing, burning barns down, being declared the black sheep of the family?
― George 'the Animal' Steele, Saturday, 4 March 2006 16:33 (twenty years ago)
― ng-unit, Saturday, 4 March 2006 16:35 (twenty years ago)
― Ned Raggett (Ned), Saturday, 4 March 2006 16:35 (twenty years ago)
How do you know? Ned just indicated there aren't any Orkish/English/English/Orkish dictionaries or Ork scholars.
― George 'the Animal' Steele, Saturday, 4 March 2006 16:40 (twenty years ago)
― Ned Raggett (Ned), Saturday, 4 March 2006 17:00 (twenty years ago)
― ng-unit, Saturday, 4 March 2006 17:04 (twenty years ago)
― James Slone (Freon Trotsky), Saturday, 4 March 2006 17:26 (twenty years ago)
― George 'the Animal' Steele, Saturday, 4 March 2006 17:46 (twenty years ago)
Got the remaster Mott and after careful A/B -- and I do this for Rolling Metal and ILM exclusively -- I give you my verdict vs. the nine dollar version that Columbia's been peddling all these years. No cost effective difference. The new remaster is not quite 3 db louder and it's been expanded to a hard limit, which seems to make it sound slightly brighter and with a little more attack. BUT...and this is a really big caveat ... I was there with the original vinyl and Mott didn't sound that precise. Don't get me wrong. It sounds good but no record player sounded like that. Anyway, the original one for the 'nice price' in stores sounds much closer to my memory of the vinyl. It's warmer, more soft compressed, and when you make up the difference in the volume it sounds more joyous, if that's a good word. Particularly if you really liked "Drivin' Sister" and "I'm a Cadillac," which I did. But, if you weren't there at the start, by no means will you be disappointed by the new one. It still sounds great. No way to ruin the material, really. And, last, the color registration on the cover art is different between the two. No one at the labels ever bothers to get the two things together and align them, so the shades are clearly different. It was the same with Iggy and the Raw Power CD editions. Idiots -- can never get the color registration exactly right because THEY JUST DON'T CARE.
And ZZ Top's deluxe edition of Fandango is good. The bonus cuts don't add much but it sounds excellent, like Chrome Smoke & Barbecue and I'm gonna say more about this some time -- maybe not here. ZZ Top was one of my major bands. I lived for "Balinese" and such and the liner notes are by Tom Vickers, a label employee, who saw the '76 tour with the all the Texas wildlife onstage. And I did, too, and we definitely have differing opinions on it and you don't think his notes would be printed in the deluxe expansion if he were less than a cheerleader now, do you?
And now I'm going to watch Voyage to the Bottom of the Sea on DVD. It was an irwin allen series about a super submarine called the Seaview starring Richard Basehart and David Hedison, both of whom are dead, I think. And it was on Sunday nights during the family time. The Seaview was a sub, and subs are made of metal, so I'm in again on a technicality.
― George 'the Animal' Steele, Sunday, 5 March 2006 04:23 (twenty years ago)
― George 'the Animal' Steele, Sunday, 5 March 2006 04:27 (twenty years ago)
A gripping classical hard rock vocalist doing the raw/brutal on the cheap who appears to write her own tunes. Well??? Put this back to back with Tokyo Dragons on Saturday night and you know where all the bootboys and girls have gone.
Saturday night play: ZZ Top Fandango, Nagg, Tokyo Dragons' Give Me The Fear, Mott, 80's segment of Chrome Smoke & Barbecue.
― George 'the Animal' Steele, Sunday, 5 March 2006 08:08 (twenty years ago)
Shiny Mama don't quite cut it, I don't think. Riffs, singing, and songs all seem close but no cigar, though if I wind up truly loving one of the songs I might change my mind. "Little Angel" and "Sleazy" seem best so far; still not quite good enough. Closer is a cover of "Long Live Rock and Roll," said to be "written by Ritchie Blackmore and Ronnie James Dio."
Liking Robin Trower's *Living Out of Time,* recorded in Hamburg last Novemeber and released now on Ruf Records in Deutschland, quite a bit, though I'm wondering how people with more Trower on their shelves than I have would rate it. So far my favorite track is "Day of the Eagle," but that vote's way premature so far. It's all sounding pretty good.
And "1864" on that Brain Surgeons album does indeed slaughter rhinoceri at 50 paces.
― xhuxk, Sunday, 5 March 2006 20:54 (twenty years ago)
Business section of LA Times had an article on Gene Simmons' ventures on Saturday, of which there are many. He's heavily invested in the Indy Car Racing League and has a pay-per TV channel coming called No Good TV. He has a magazine called Gene Simmons Game and a record label, Simmons, the latter of which appears singularly unsuccessful. It put out the album by BAG, which has sold 100 copies. I've never even seen BAG.
― George 'the Animal' Steele, Sunday, 5 March 2006 21:17 (twenty years ago)
It is, in fact, live. (Just realized I wasn't totally clear about that in my previous post.)
― xhuxk, Sunday, 5 March 2006 21:47 (twenty years ago)
Was in Tower yesterday and they have this "what Jonesy likes" promotion. It's what the dude from the Sex Pistols supposedly likes on his radio show and of the things, it's the usual ridiculous-appearing to me -- newly mints from major labels discounted to 11 dollars for a week. First, the Casanovas, advertised as sounding like AC/DC with a shot of bourbon but since AC/DC surely drank bourbon, the claim is just an invitation to a fat lip and busted nose. Why does anyone go with stuff like this as blurbs? They dumb?
Then there was the Lashes. They looked like sissies who wore black. And then there was something called New [Fill in the blank cause I forgot] Donkey with a guy doing an AC/DC Angus Young pose on the cover. Which sure seemed like an invitation to get run over by a car.None of it was on listening stations. But it sure looked like these were being sent around by the bushel bag in promo dole, so can someone enlighten? 'Jonesy' would probably recommend wearing Ex Lax if someone paid him twenty dollars.
― George 'the Animal' Steele, Monday, 6 March 2006 16:37 (twenty years ago)
― xhuxk, Monday, 6 March 2006 16:56 (twenty years ago)
Anyway, the Gooz tells me by phone that he bought Wolfmother on the basis of early claims. And he said it sounded half like Zeppelin and half like the White Stripes and I said he sounded like he was describing a reason to sending it to the used store pile and after he chewed it over awhile he conceded that was true. He did say he liked the Sword CD, which was also promoted by Girlie and which I still do not like, which shows a busted watch is still right twice a day.
― George 'the Animal' Steele, Monday, 6 March 2006 17:28 (twenty years ago)
* -- CD insert thing also compares them to flipper, which is baloney. are pissed jeans this shitty, too? if so, i'm not missing anything.
― xhuxk, Monday, 6 March 2006 18:47 (twenty years ago)
― xhuxk, Monday, 6 March 2006 19:01 (twenty years ago)
Got the new Place of Skulls disc in the mail this weekend. Wino's gone, but the rhythm section seems to be the one from the second album, plus guest spots by the bassist from the debut on a few tracks. Victor Griffin's guitar and vocals the selling point, of course, and they're very melodic-early-Sabbath, as always. It's a solid disc with no hope of escaping the ghetto. On Exile on Mainstream Records - the first thing I've really liked from them.
― pdf (Phil Freeman), Monday, 6 March 2006 19:16 (twenty years ago)
― ng-unit, Monday, 6 March 2006 19:21 (twenty years ago)
― pdf (Phil Freeman), Monday, 6 March 2006 19:23 (twenty years ago)
Yeah, I like that album quite a bit. Few young bands are attempting the kind of good vocal melodies that Griffin pulls off.
― a. begrand (a begrand), Monday, 6 March 2006 19:59 (twenty years ago)
― a. begrand (a begrand), Monday, 6 March 2006 20:00 (twenty years ago)
Meh.
― Brian O'Neill (NYCNative), Tuesday, 7 March 2006 09:44 (twenty years ago)
― scott seward (scott seward), Tuesday, 7 March 2006 13:47 (twenty years ago)
― scott seward (scott seward), Tuesday, 7 March 2006 13:57 (twenty years ago)
― xhuxk, Tuesday, 7 March 2006 14:07 (twenty years ago)
Facedowninshit's eyehategod-worship just isn't that compelling to me. sounds okay i guess. ultralord have better riffs. naming one of your songs "plasma center blues" does not a crusty legend make.
i wanna hear the new gathering. i liked the last album, but i certainly didn't play it as much as previous albums.
― scott seward (scott seward), Tuesday, 7 March 2006 15:39 (twenty years ago)
― pdf (Phil Freeman), Tuesday, 7 March 2006 15:52 (twenty years ago)
― xhuxk, Tuesday, 7 March 2006 15:59 (twenty years ago)
― scott seward (scott seward), Tuesday, 7 March 2006 16:04 (twenty years ago)
I have the Unearthly Trance and Facedown albums but have yet to listen properly (or improperly).
― Ned Raggett (Ned), Tuesday, 7 March 2006 16:06 (twenty years ago)
― scott seward (scott seward), Tuesday, 7 March 2006 16:11 (twenty years ago)
― xhuxk, Tuesday, 7 March 2006 17:40 (twenty years ago)
― xhuxk, Tuesday, 7 March 2006 17:59 (twenty years ago)
"She's a Six" is math rock. You funny guy. "When she's drinking wine, she's a six point nine-nine-nine. // She hangs around with other chicks; and thinks the wrestling team is a bunch of a dicks." Single of the year so far, easy."
My research into Nagg led me to find there are TWO all girl AC/DC tribute bands: AC/DShe and Hells Belles. One is from SF, the other from Seattle. And Amy Ward of the Nagg is "Bonny Scott" and Adrian Conner in Hells Belles plays Angus "Schoolboy" Young, complete in uniform.. Startlingly, Adrian has a CD on CD Baby called Adrian for President by Adrian and the Sickness, and I have not heard it yet.
― George 'the Animal' Steele, Tuesday, 7 March 2006 18:29 (twenty years ago)
It's better than Souvenirs, it's nowhere near as fussed over, a little looser. xhuxk's right, there's a Kate Bush vibe running through "Alone" that is actually really cool. "A Noise Severe" has Anneke doing that full-on singing she did back around Mandylion.
― a. begrand (a begrand), Tuesday, 7 March 2006 18:41 (twenty years ago)
ENFORSAKEN *Sinner's Intuition* gets the gong by me. Just ugly. Though I suspect I'd find a hidden melody or two if I cared to hunt for them.
― xhuxk, Wednesday, 8 March 2006 17:48 (twenty years ago)
Maybe because they brought it back into print as a remaster. Or it's a fourteen year anniversary, or they think it's fifteen and can't count.
Or they're lurking, like others, on this thread, and they're seeing how much a couple of us like this stuff with no expiration date. Or you asked 'em and they had leftovers like you said.
Dind't flip on Pentagram yet but I was getting some laughs out of the bio. I can't imagine Paul Stanley and Gene Simmons ever liking Pentagram even though they went out to the house to see a rehearsal. More 'n' likely they were looking to score some neighborhood girls and when it didn't happen they turned surly. Laugh-a-minute comments -- your drummer is fat, the bass player has bad skin, and the guitarist only stands in one place.
I was discussing this with the Gooz the other day. Pentagram, despite having a decades long catalog, never PLAYS anywhere. They're the one indie metal band that never imposes itself upon us. Remasters and reissues and new CDs galore, but they're still ghosts. Someone in the band must have a phobia about leaving the apartment.
― George 'the Animal' Steele, Wednesday, 8 March 2006 18:33 (twenty years ago)
Helix were a fun band, a guaranteed good live act back in the 80s. Saw them in 85 and 87. Their singer Brian Vollmer has a new autobiography just out, and it's supposed to be very good.
Whenever I think of Helix these days, I'm reminded of Trailer Park Boys:
Ricky: Helix, now they had good lyrics. Gimme an R - O - C - K, and the crowd yells 'rock' really loud, now that's what I call a fuckin' concert.
Bubbles: I'm not givin' anyone a fuckin' 'R'.
― a. begrand (a begrand), Wednesday, 8 March 2006 21:30 (twenty years ago)
Yeah, I think she does this in "Your Troubles Are Over," too. (Though does she really not sing full on *How To Measure a Planet?* That seems odd to suggest, but maybe you're right.) "Forgotten" and "Box" seem to be two of the new album's more new agey/ambient tracks, and they're therefore two of the ones I like least, though I like how "Box" zooms into space music at the end. "Shortest Day," the opener, is really good - I think it might be one of the first Gathering songs where the words might actually might sense! Seems to be about some guy, though I'll need to listen more to get the specifics. And "Alone," beneath the prettiness that's so easy to take for granted with these guys, is a stomp. So maybe the album's a return to rock after all, in a way.
― xhuxk, Wednesday, 8 March 2006 21:38 (twenty years ago)
What do you make of "Solace"? That's the only track that stuck in my craw. It's a strange one.
― a. begrand (a begrand), Wednesday, 8 March 2006 21:52 (twenty years ago)
Anyway, I mention this because the band reissued its first two discs and also put out a new recording recently - I think they did it all themselves since there isn't any label info on this and I have trouble seeing this as worthy of booting. I just got the reissued debut in my store (I got it from The End so it might be available there through their mail order) and I decided to spop it in ans see why I liked it in the first place.
Holy shit, is it good! The first voice you hear is an operatic female and the first riff you hear is quite Gothic in texture and deed! I need to check but this seems quite early for this kind of thing, taking cues from Into The Pandemonium and trad Gothic stuff. When the band gets about to thrashing and grinding, it's also quite good, mixing up the tempos (I like the slower stuff better, which is good because there's more of it) and with a decent production fo the era (maybe it was remastered?).
Very often the underground metal stuff I revisit after a decade makes me wonder what the hell I was thinking. This one makes me wonder why I haven't played it in so long.
― Brian O'Neill (NYCNative), Wednesday, 8 March 2006 22:07 (twenty years ago)
Ha-ha, "Virgin Death" uses a Yardbirds riff as its central theme. Great! Next up, something West Bruce & Laing would have been happy to play, "Politician" sped up and surgically simplified.
― George 'the Animal' Steele, Wednesday, 8 March 2006 23:27 (twenty years ago)
Long spacious holding pattern, with time-outs for French words. Performance art, more or less - reminds me of Laurie Anderson, for some reason. Mainly, it bores the heck out me....Not sure why I thought "Shortest Day"'s words made sense. Here's the most coherent part, near as I can tell: "Aggravation is appreciated/He'll use you like a tool/Association is overated/[?????] are for fools." Well, it *sort* of makes sense, I guess. Maybe it makes more sense to Anneke. She certainly *sings* those lines like they make sense, which is probably what I meant...Also not sure what I meant by calling "Alone" a "stomp." It's a sort of electro-industrial rock battle march or something. Vaguely dancey. Still not bad. (Speaking of electro-industrial rock battle marches, can I plug the new album by Japanese Chemical Prodigy types the Boom Boom Satellites here? Oh, I just did. It sounds good.)..Also on the new Gathering album, "The Quiet One" is a quiet one and the title track "Home" has more metal doom, though I'm probably not enough. Still, not a bad record, and "Shortest Day," "A Noise Severe," and "Your Troubles Are Over" are worth keeping around the house. Better album than *Souvenirs.* WAY better album, I think, than *Sleepy Buildings: A Semi-Acoustic Evening.* Possibly better than that other live album they put out a couple years ago, *If...Then...Else* or whatever it was called. Probably better than their 2005 DVD *A Sound Relief,* which I still haven't gotten around to watching once. DVDs are fucking impossible. I think I watched their previous one. The Gathering are hard to keep up with.
― xhuxk, Thursday, 9 March 2006 01:14 (twenty years ago)
― xhuxk, Thursday, 9 March 2006 01:18 (twenty years ago)
― xhuxk, Thursday, 9 March 2006 01:21 (twenty years ago)
I wound up giving the new album a positive review...I can't not like it. Even its flaws are pretty. And yeah, I'm close to thinking it's their best since How to Measure a Planet...
― a. begrand (a begrand), Thursday, 9 March 2006 01:59 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 02:02 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 02:04 (twenty years ago)
>QUOTA, from Canada (not sure where in Canada exactly)<
Recorded in Winnipeg, Manitoba, the inner sleeve says. So maybe from around there.
― xhuxk, Thursday, 9 March 2006 02:07 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 02:08 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 02:11 (twenty years ago)
― xhuxk, Thursday, 9 March 2006 02:34 (twenty years ago)
― a. begrand (a begrand), Thursday, 9 March 2006 03:03 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 03:35 (twenty years ago)
Enslaved did an acoustic set for Norweigan radio a while back and it was fucking amazing.
― Thomas Tallis (Tommy), Thursday, 9 March 2006 04:31 (twenty years ago)
― baby, disco is fuck (yournullfame), Thursday, 9 March 2006 05:09 (twenty years ago)
― xhuxk, Thursday, 9 March 2006 15:13 (twenty years ago)
― xhuxk, Thursday, 9 March 2006 15:20 (twenty years ago)
― xhuxk, Thursday, 9 March 2006 15:28 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 15:29 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 15:31 (twenty years ago)
― xhuxk, Thursday, 9 March 2006 15:41 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 15:46 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 15:53 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 16:10 (twenty years ago)
CM seems to have a pretty narrow vision of what they can actually sell. I mean, I like a lot of their artists (Cryptopsy, God Forbid, Arch Enemy), but I can't believe they tossed Yakuza out the door after only one album.
― pdf (Phil Freeman), Thursday, 9 March 2006 16:29 (twenty years ago)
Had a decent album a couple years ago. Did a complete cover -- middle section and all -- of the James Gang's Bomber suite. Virtually perfect, down to the Joe Walsh yowl. So they didn't sound much like a stoner rock band for that record, a distinct benefit. Haven't heard the latest although I could, I guess.
Five Horse Johnson
Checked out after one album sounded like bad Savoy Brown and stoner hybrid. Throttlerod, no opinion, although they sure have the image of generically stoner. The only stoner metal bands that are interesting now are ones that aren't "good" at it or are arty. Everyone else -- the really minor faves and such -- all sound the same. They get the same guitar sound, invariant downtuned wall of lava, and he-man shouting vocals. And they barely rock and roll, which is damn peculiar since they all profess to be influenced by 70's bands that were very rock and roll.
Second CD of Pentagram stuff on FDH, Too -- the rehearsal hall tapes -- sounds in the exact same area as the live Halloween 2004 Josefus thing I spoke of upstream. I still like the first CD, the 'mersh stuff, better. So stoner bands ought to listen to it and take notes.
― George 'the Animal' Steele, Thursday, 9 March 2006 16:41 (twenty years ago)
― pdf (Phil Freeman), Thursday, 9 March 2006 17:11 (twenty years ago)
Blurb for Bacon & Egg's ...are Fanduvo on CD Baby. Produced by a Fucking Champ in San Francisco. Two guys with organ, drum machine and guitar doing rap metal BS, as in Black Sabbath. Yurgh.
― George 'the Animal' Steele, Thursday, 9 March 2006 17:14 (twenty years ago)
― pdf (Phil Freeman), Thursday, 9 March 2006 17:22 (twenty years ago)
http://cdbaby.com/cd/baconegg
― George 'the Animal' Steele, Thursday, 9 March 2006 17:32 (twenty years ago)
― pdf (Phil Freeman), Thursday, 9 March 2006 19:23 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 19:27 (twenty years ago)
"NH-044 ILDJARN "Ildjarn Is Dead" 2xCD (17,-)CD version also includes 2nd disc with Ildjarn’s ”93” and ”Minnesjord – The Dark Soil” vinyls, plus 20 more minutes of bonus material never before released, a total of over 2,5 hours of playing time.Note from the recording artist:Before purchasing this product you should take great care in observing the following requirements in relation to it:After long-term use of this product you may experience increased hatred, thus a lust to kill partcipants of your own breed subsequent to and while operating this product may consequently occur. The copyright owner of this audio product and all its accompanying propaganda declares that it is in compliance with the essential requirements of antilife, and hereby assumes all liability for any injury or death caused by the use of this product. If inexperienced with the kind of hateful and suicidal contents distributed through this product, you should seek the advice of experienced misanthropists and death-worshipers before operation, to assure proper use and to prevent the interference of alien thoughts originating from philanthropists, which will most likely harm the process that may be the result of using this specific product. This product is furthermore solely intended for use in a solitary confinement, and should not be subjected to any other use. Following these rules, this recording and the accompanying words will provide a lifetime of pure frustration, caused by the newly acquired knowledge of the insufficiencies and absurdities of earthly life. If failing in the harsh process of submitting to these rules subsequent to your purchase, users are strongly urged to give away this product to a being willing to obey to the unwritten laws conceived by the sources of death’s path, and ultimately the annihilation of the self. Again, be sure to consider all the above requirements prior to your purchase."
― scott seward (scott seward), Thursday, 9 March 2006 19:28 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 19:32 (twenty years ago)
Bacon & Egg Are Fanduvo is the duo’s lionhearted debut album and living proof of what a drum machine and two sure-handed, talented musicians can do.
Like two adventuring champions of sound, Bacon and Egg sing, rap and chant their way through this jungle of precarious beats and hard-driving melodies. The album is lush with ambitious rock compositions infused with a touch of hip-hop ingenuity. Volumen bassist Bryan Hickey (Biscuit) chimes in as a featured vocalist on three tracks, “Monsters of Rock,” the entrancing “Scent of Ben Gay” and “Sun on Thundar,” and someone called “Retardo Montalban” lends backing vocals on “Stains on the Window Pane.”
-- some college newspaper in Montana
Bacon and Egg's DIY collage consists of roughly equal portions of Juggalo in heat, jock jam, Medieval art-rock (they sometimes refer to each other as knights) and backwards metal. They fuel their music with drum machine, lots and lots of distorted guitar, organ for the bass duties, and a dash of Prog for style. Every track fits into one of three categories: epic instrumental, epic instrumental punctuated with hip-hop spitting, and epic instrumental with Jello Biafra-cum-rockabilly vocals -- provided by Bacon & Egg's similarly breakfast-named cohort, Biscuit.
--Splendid
Very inventive and addictive, Bacon & Egg meld guitar rock lines with light rap a la early Beastie Boys. But not limited to that sound they vary between sounding like Bloodhound Gang, Tenacious D, and Devo. Really an interesting spectrum to be a part of, it gives the album nice contours as it progresses so that no two songs feel similar.
The key to the success of the record is the interaction of the drum machine and the guitar lines. Normally, I hate drum machines, but here it is used effectively so that it doesn't become monotonous. The drum lines are simple yet driving, and add a nostalgic feel to the material as they provide ample beat. The guitar lines are equally basic and inspired and when combined with the drums create a nice base for the rest of the material to fall into place. The vocals are straightforward, hitting the correct rhythm emphasis points and accenting the head-nodding appeal. "Formerly D-11" and "Stains on the Window Pane" are well conceived and worth listening to, but it is "Sun On Thunder" that I will continue to come back and listen to for its perfect blending of all of the above.
-- Hybrid
Still, there’s a thoroughly satisfying quality to hearing the goofy musings of a pair of music buddies, united in their quest for … hmmm … ridicule? It’s hard to tell. Anyway, tracks like “Suburban Hustler”—a hand-clappin’ Nintendo soundtrack throwback about a fly, Walkman-sporting, would-be pimp who prowls around on a Mongoose bike—serve up such perfect imagery of misplaced cool they simply must be blasted through whatever open windows are available. Sure, it might get you beat up, and it will get you laughed at, but that might be the point.
Besides a mastery of exquisitely bad rap—see (“He’s got mad moves and a sense of style/Make the other homeboys look like a dogpile”) Bacon and Egg have an appropriately loose grasp on punk rock/new wave flavor (“Sun on Thundar,” “Monsters of Rock”) and riff-laden, drunkenly psychedelic instrumentals.
Bacon and Egg are Fanduvo offers an omelet filling for everyone, and—like a greasy diner breakfast—it may be crap, but it sure tastes good.
-- some dumb weekly in Bend, Oregon.
BACON & EGG, a duo from Missoula MT, have undertaken their first album, recorded by Tim Green in Louder Studios; because of this fact, it isn't really surprising that you find the same over-stretched Metal-riffs used by them as by the Champs. But really they have more in common with Rap than metal, mixed with an ample oblique sloping feel for rhythm, that is reminiscent of the Dead Kennedys and Punk in general, or a rhythm that one finds good in songs in general. If you can get used to this scurrilous mix, as well as to the cheap drum-machine, BACON & EGG are, to be sure, not much easier to digest, but they do develop a surprising entertainment value. With their tasteless Electro-Rap-Metal they are similarly unique to Devo back in the day, but perhaps one shouldn't place too much importance in such statements, especially when it is certain that these are the funniest White Motherfuckers since the Beastie Boys to have appropriated from good black underground music. The cover already gives the album bonus points: It features a record-album scenario with a castle, dragon and knight, done in a cheap comic book style. In the air are flying monkeys, that seem to be on loan from the Wizard of Oz.
-- some 'zine from Deutschland
I often have my doubts about 'side projects', but when they sound like this CD - a side project from two members of Volumen, combining the best in 1980s drum machine technology, hair metal widdling and lame white boy rapping - who am I to complain? This is further evidence that Missoula, Montana is stuck in some kind of time warp where it's forever the mid-80s. Breakdance-style simplistic drum patterns are augmented by the wailingest of wailing guitars, ably recorded by Tim 'Fucking Champs' Green. The riffs come hard and fast. Heads down, devil horn fingers in the air, and ROCK. The toasting on the M.I.C. sounds like a teenager showing off to capture the attention of a group of cheerleaders. The perfect combination of point and pointless.
-- some Scottish 'zine
― George 'the Animal' Steele, Thursday, 9 March 2006 19:50 (twenty years ago)
I am listening to Darsombra now and they are nicely relaxing my brain, which has been sinus headachey all day. As always, industrial doom drone bullshit sounds best when I'm feeling under the weather.
Which means I might well be in a good mood for new Moonspell (which just showed up in the mail) as well. But I think I'll draw the line at Fields of Nephillim. (Were they ever any good? Scott would know.)
No cover versions on new Dixie Witch or Five Horse Johnson: Bad sign.
― xhuxk, Thursday, 9 March 2006 19:56 (twenty years ago)
ask ned. or alex in nyc. i drew the line with sisters of mercy.
i like that darsombra cd. spooooooooky.
― scott seward (scott seward), Thursday, 9 March 2006 20:11 (twenty years ago)
― pdf (Phil Freeman), Thursday, 9 March 2006 20:13 (twenty years ago)
Holy fuck. Do they plan on making the recording available?
― James Slone (Freon Trotsky), Thursday, 9 March 2006 20:18 (twenty years ago)
― James Slone (Freon Trotsky), Thursday, 9 March 2006 20:22 (twenty years ago)
atomic bitchwax tricky woo nebula bad wizard the high strung raging slab all night mark d hermano black nasa core sleep boulder the mystick krewe of clearlight lost goat high on fire
you know, cuz of a thread on ilm, i put on *king of the road* by fu manchu a couple weeks back, and THAT is the kind of stoner rock i wouldn't mind hearing from someone now. something with a little zing! a little pep! you know? i got doom and sludge coming out of my ears. i need something for my cardio workouts!
― scott seward (scott seward), Thursday, 9 March 2006 20:25 (twenty years ago)
All Night were pretty fair at doing a swinging and souther take on stoner. Never saw more than one album by 'em. Boulder sometimes sounded like Ted Nugent on Reaped in Half and then disappeared. And Lost Goat had a chick frontwoman and I reminder listening to it once and then banishing it forever.
― George 'the Animal' Steele, Thursday, 9 March 2006 20:32 (twenty years ago)
― pdf (Phil Freeman), Thursday, 9 March 2006 20:34 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 20:52 (twenty years ago)
― pdf (Phil Freeman), Thursday, 9 March 2006 20:54 (twenty years ago)
― a. begrand (a begrand), Thursday, 9 March 2006 21:14 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 21:33 (twenty years ago)
― scott seward (scott seward), Thursday, 9 March 2006 21:38 (twenty years ago)
― pdf (Phil Freeman), Thursday, 9 March 2006 21:42 (twenty years ago)
boulder (TWO albums by them still on the shelf! They rocked.)the mystick krewe of clearlight (some kind of supergroup, right?)lost goat (I think I LIKED their chick singer. can't remember why.)
Always thought these ones were fairly overrated:
atomic bitchwax (see 2005 metal thread)nebula (see above; they've had moments, I guess)bad wizard (first album was best; been downhill from there)raging slab (who george mentions a lot, so maybe I UNDERRATED them? At the time, though, I sure didn't buy the Black Oak Arkansas shtick.)
And I vaguely recall Hermano having a slight Thin Lizzy bent, but I might be completely off on that. Had a Man's Ruin album by them once.
That All Night album wasn't bad. Not sure if I still have it or not.
― xhuxk, Thursday, 9 March 2006 21:47 (twenty years ago)
― xhuxk, Thursday, 9 March 2006 22:01 (twenty years ago)
Anyway, Raging Slab were part of a passel of signings of mostly NYC bands in this vein. The debut was mixed by Gary Lyons who was a real vet at 70's Brit boogie rock, although his major calling card was working with Foreigner and Madonna. He drank a totally flabbergasting amount of booze during the sessions, effectively putting everyone in the booth with him who went along, heeled over in the corner. This, I think, was the idea. It winnowed out interference and inteferers.
And he did a pretty good job on the first Slab album which featured a video that got some MTV play. But it never quite took off and RCA lost interest which caused a legal wrangle. At which point they went to Def American. And made two albums, the third which was an art record of sorts, and Def American became disinterested and put them in contract hell for a few years, refusing to release records while the band kept submitting studio sessions.
And then the contract expired and they wound up on Teep Pee. I heard the first, which was good, and haven't heard the second, Eat Shit, with the Lynyrd Skynyrd-style cover art. They would tour in Europe and be popular in Scandinavia, and at one point Greg Strzempka was actually in Sweden or Norway as frontman for a native band doing American boogie rock. I'm fuzzy on the details but I think that's a general outline.
And now I don't have to say nuffin' about it for another ten years.
― George 'the Animal' Steele, Thursday, 9 March 2006 22:44 (twenty years ago)
Sort of the Pussycat Dolls of their time, I seem to recall - three or four female non-playing vocalists, with an all-male band of anonymous hacks behind 'em.
― pdf (Phil Freeman), Friday, 10 March 2006 01:11 (twenty years ago)
― pdf (Phil Freeman), Friday, 10 March 2006 01:25 (twenty years ago)
With the dominatrix look. They kind of yelled more than they sang, too. Can the Pussycat Dolls sing?
― George 'the Animal' Steele, Friday, 10 March 2006 01:30 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 10 March 2006 01:47 (twenty years ago)
Main stage acts for Ozzfest 2006 include SYSTEM OF A DOWN, DISTURBED, HATEBREED and LACUNA COIL. Second Stage artists are ZAKK WYLDE’S BLACK LABEL SOCIETY, ATREYU, UNEARTH, BLEEDING THROUGH and NORMA JEAN. Others bands scheduled to appear include STRAPPING YOUNG LAD, THE RED CHORD, WALLS OF GERICHO (sic), A LIFE ONCE LOST, BETWEEN THE BURIED AND ME, FULL BLOWN CHAOS and ALL THAT REMAINS.
It's like Hot Topic comes to your local amphitheater.
I honestly only care about two bands here: Lacuna Coil and Strapping Young Lad. I hope I don't have to go.
― Brian O'Neill (NYCNative), Friday, 10 March 2006 02:52 (twenty years ago)
Even worse than the existing Ozzfest lineup is the fact that the only good bands (Lacuna, SYL, Red Chord), will likely only get 20 minutes each. What a joke. Sounds of the Underground is looking to be much more fun, with In Flames, Cannibal Corpse, Behemoth, and others.
― a. begrand (a begrand), Friday, 10 March 2006 02:55 (twenty years ago)
― ng-unit, Friday, 10 March 2006 03:10 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 10 March 2006 03:11 (twenty years ago)
― ng-unit, Friday, 10 March 2006 03:15 (twenty years ago)
In Flames got only 20 minutes on the main stage last year, so the similar treatment of Lacuna Coil wouldn't surprise me at all. And we all know Disturbed, Hatebreed, and Sharon's lapdog Zakk will get the bulk of the time.
― a. begrand (a begrand), Friday, 10 March 2006 03:22 (twenty years ago)
― a. begrand (a begrand), Friday, 10 March 2006 03:23 (twenty years ago)
I also listened to the Eddie Ojeda disc. The Dio song was fun. The rest was pretty boring in an old-fart-sounds-dated way.
Additionally (I had some time at the store to throw in newish stuff) I checked out the Capricorns disc that Candlelight finally repeased in the US - the UK metal media has buzzed about it for some time. I'm not sure about it. The band is a lot more sturdy than most of the doomsayers but just having an annoying girl screaming atop the sludge and giving it a Converge-like noise-fest feel didn't do it for me on one listen.
― Brian O'Neill (NYCNative), Friday, 10 March 2006 03:24 (twenty years ago)
i almost bought that one actually. then i realized bone awl do it better.
― baby, disco is fuck (yournullfame), Friday, 10 March 2006 03:25 (twenty years ago)
― a. begrand (a begrand), Friday, 10 March 2006 03:58 (twenty years ago)
Compliment or not?
Fields of the Nephilim = Morricone goths with Lovecraft lyrics and some bizarre lines but they all sold it for me back then at least. Their live album is the best thing they ever did!
Raging Slab I always vaguely appreciated. Had most of their CDs for some years.
― Ned Raggett (Ned), Friday, 10 March 2006 04:04 (twenty years ago)
― pdf (Phil Freeman), Friday, 10 March 2006 13:11 (twenty years ago)
Definitely not. They suck ass bigtime, and I'm not a masochist. Though given their name, they might at least have self knowledge about their suckage. (Throwing up on shoes isn't as bad as being face down in shit, I guess, but they may well be related predicaments.)
― xhuxk, Friday, 10 March 2006 14:13 (twenty years ago)
― scott seward (scott seward), Friday, 10 March 2006 14:34 (twenty years ago)
― scott seward (scott seward), Friday, 10 March 2006 14:36 (twenty years ago)
― pdf (Phil Freeman), Friday, 10 March 2006 15:46 (twenty years ago)
Moral of the story: They're into a local niche for college students in Missoula, MT. You know, the ones who can't drink too much so they don't go to the really big frat orgies where the jocks go, and in their entertainment, they look for acts that are bad on purpose, so they can pretend to like them and act and sardonic and wry in front of each other while flashing the horns hand sign. I rarely try to coin names but I'll offer one for the genre: Wretchcore. As in wretched as a plan of action.
And there would be no way, xhuxk, that I'd crack open that Volumen thing after listening to are Fanduvo. Volumen were advertised as "heavy new wave and nerd rock" from Missoula, MT. Allegedly much beloved by the local students and also responsible for Bacon & Egg.
― George 'the Animal' Steele, Friday, 10 March 2006 17:05 (twenty years ago)
there is an EXCELLENT record store in Missoula if you are ever driving thru: *Rockin' Rudy's* Lots of used Blue Cheer and Captain Beyond records when I was there. That must say something about the area. I picked up tons of great cheap stuff including a Steamhammer record.
― scott seward (scott seward), Friday, 10 March 2006 17:18 (twenty years ago)
dixie witch album actually turns out to be pretty good. singer's way too muffled most of the time, so it's rare when they put over an actual song, but they do have riffs, and track 8 "what you want" is a southern boogie that would actually make montgomery gentry jealous i bet ("i'm gone/southbound on a northbound train" -- uh, i'm not sure that's *possible*, dudes). track 4 "out in the cold" is a sort of doomy grunge ballad, kinda reminds me of pearl jam or alice in chains or one of those schmoes, but i actually *like* it, for some reason. track #9 "gunfight" is a loud rhyming shout, could almost pass for kid rock at his most bad company (or whatever). track 11 "last call" is a sad maggot-brained guitar instrumental that stretches for nine and half wandering minutes, and is quite lovely i must say. also not bad: "s.o.l." "ballinger cross," i forget what else. they'd do a lot better getting a real singer, but i can live with the guy they have.
more than i can say for the singer of Graves At Sea. he sounds as ridiculous as that creep in khanate. i bet they share fans, right?
― xhuxk, Friday, 10 March 2006 17:19 (twenty years ago)
Yup. Somehow he got a hold of the first Comsat Angels album when it just came out (but was unreleased in the States) over there too, which allegedly changed his life.
― Ned Raggett (Ned), Friday, 10 March 2006 17:20 (twenty years ago)
doomy "THREE O'CLOCK IN THE MORNING" (they say) grunge ballad (which is part of its appeal) (though in 1995 I would've hated it, I'm sure.)
― xhuxk, Friday, 10 March 2006 17:25 (twenty years ago)
Bacon & Egg were CD Baby offered. Ooof.
Like two adventuring champions of sound, Bacon and Egg sing, rap and chant their way through this jungle of precarious beats and hard-driving melodies. The album is lush with ambitious rock compositions infused with a touch of hip-hop ingenuity.
The college newspaper wrote this. Bacon & Egg failed to mention they are either editors of it or someone is a girlfriend.
― George 'the Animal' Steele, Friday, 10 March 2006 17:29 (twenty years ago)
― scott seward (scott seward), Friday, 10 March 2006 17:34 (twenty years ago)
Throttlerod - Disclosure: A friend manages them and I did their bio. The group is not really stoner rock anymore, although you can tell they dig that stuff. The last disc shows that other sounds are apparent - namely a touch of speed, a touch of disjointedness, and a touch of really mellow stuff on the EP they last did. I do like the band though.
Raging Slab - I became friends with Greg and Elise after I met them when I moved back to NYC. However before that I remember seeing "Don't Dog Me" on the Headbanger's Ball as a young'un and liking it. So I got all of the band's older stuff and really loved what I heard. I like most of the band's output except for the last American recording, which is just depressing. They still put on a hell of a show live.
Fields Of Nephilium - I went on an eBay kick with this band a couple years back, buying their entire catalog. I like a good chunk of it but I was always a sucker for Goth/Industrial bands that feature prominent guitar. The band's most "metal" moment - a release just under the name Nefilium because of (something odd involving who owned the name but I forget specifics) - is my favorite, which I suppose isn't too surprising.
― Brian O'Neill (NYCNative), Friday, 10 March 2006 17:38 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 10 March 2006 17:40 (twenty years ago)
― George 'the Animal' Steele, Friday, 10 March 2006 19:00 (twenty years ago)
― scott seward (scott seward), Friday, 10 March 2006 19:29 (twenty years ago)
― Ned Raggett (Ned), Friday, 10 March 2006 19:31 (twenty years ago)
― scott seward (scott seward), Friday, 10 March 2006 19:33 (twenty years ago)
― scott seward (scott seward), Friday, 10 March 2006 19:36 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 10 March 2006 19:58 (twenty years ago)
― scott seward (scott seward), Friday, 10 March 2006 20:07 (twenty years ago)
WHO IS RESPONSIBLE!!!
― Brian O'Neill (NYCNative), Friday, 10 March 2006 20:12 (twenty years ago)
I was of the opinion Creem Metal was vastly superior to its prime competitor, RIP, but RIP outlived it, had the advertising, the glory, the cooperation of the industry and the circulation. Circus outlived it, too, and that was a genuinely dreadful magazine by then, too.
Dick Destiny & the Highway Kings wouldn't have existed if it hadn't been for xhuxk's indie reviews in Creem Metal. Creem actually sorta moved to New York, or at least the editors did, and became Revolution for two or three issues, which then folded. Mike Saunders, xhuxk and I did a roundtable in one issue on heavy metal guitarists that's now on-line for syndication somewhere -- Barry Hoskins' site, I think.
I'm surprised I can remember any of this. Better go take a few Aricepts.
― George 'the Animal' Steele, Friday, 10 March 2006 20:42 (twenty years ago)
Yes.
― Ned Raggett (Ned), Friday, 10 March 2006 20:44 (twenty years ago)
1) My first non-fanzine-type assignment was an interview with Wrathchild America that ran in... Creem Metal! I totally forget who assigned it but it was in 1990, I believe.
2) I actually got a check ! I think I still retain a copy of it in my records that I used to put up in offices (when I worked in offices) like a restaurant would put up the first dollar they got.
3) Years later, the latest incarnation of Creem would die, owing me thousands of dollars that I would never see again.
The more things change... The older I get.
Thanks to those of you who helped spur an adolescent to new and exciting heavy music. Without you guys, I wouldn't have become what I am now. It's all your fault...
(Also, wasn't Sprague involved in some capacity? I recall his name for some reason...)
― Brian O'Neill (NYCNative), Friday, 10 March 2006 20:48 (twenty years ago)
I can! And do! Every month! For real! No, really! Well, sorta!
― scott seward (scott seward), Friday, 10 March 2006 20:51 (twenty years ago)
― George 'the Animal' Steele, Friday, 10 March 2006 20:58 (twenty years ago)
― xhuxk, Friday, 10 March 2006 21:16 (twenty years ago)
― xhuxk, Friday, 10 March 2006 21:19 (twenty years ago)
"ruined"? Please elaborate.
― JayBabcock (jabbercocky), Friday, 10 March 2006 22:52 (twenty years ago)
― George 'the Animal' Steele, Friday, 10 March 2006 23:01 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 10 March 2006 23:11 (twenty years ago)
Bands that don’t take themselves very seriously and are more inclined to make funny songs can go one way or the other; they can either make you laugh or turn you off completely. It usually doesn’t help things when the songs aren’t good either. Bacon & Egg are damn funny and will make you laugh—indeed their bio sheet reads like a cast-off from the Renaissance Festival. But their songs are laughably bad too. Maybe it’s intentional in a sort of Atom & His Package kind of way but it might not be. If you want to hear somebody with a guitar, a drum machine, a keyboard, and a lot of funny juice stocked up write bad rap-tinged jams, then by all means buy this album, otherwise avoid it like the ‘Noid.
-- Smother magazine
This is a pretty funny and strangely enjoyable disc. The opening track, "Track 2" is a ridiculous instrumental Miami Vice-soundtrack sound meets old-school metal guitar virtuosity. It's not really a great song so much as it sets the mood for what you are about to hear. You get more goofy guitar wankery coupled with electronic keys, programmed beats and retarded white-boy raps like "My mind keeps thinking of the thoughts in my mind" or "On the streets in the Cul-de-sacs, livin' life to the ultimax" (on Suburban Hustler). Things are very samey throughout the disc, but the vocals are the highlight. They're definitely good for some laughs, and probably make for a great live experience. The guitar sounds are thick like hot, smelly tar and sound pretty cool coupled with the sprightly. 1980s quality (I'm thinking DeBarge here) electronic accompaniment. Occasionally you get some really weird and cool tunes that depart slightly from the formula like "Ajax Hole" (another instrumental that sounds like an some sort of arctic sci-fi dirge).
-- Odyssey 'zine
― George 'the Animal' Steele, Friday, 10 March 2006 23:24 (twenty years ago)
"George, have you heard The Indian Tower, by Pearls and Brass? I'm liking it a lot"
― JayBabcock (jabbercocky), Friday, 10 March 2006 23:34 (twenty years ago)
-- pdf (newyorkisno...), January 25th, 2006.
― George 'the Animal' Steele, Friday, 10 March 2006 23:39 (twenty years ago)
― JayBabcock (jabbercocky), Friday, 10 March 2006 23:49 (twenty years ago)
― George 'the Animal' Steele, Friday, 10 March 2006 23:54 (twenty years ago)
― JayBabcock (jabbercocky), Saturday, 11 March 2006 00:13 (twenty years ago)
Two Boulder CDs on my shelf: *Reaped In Half* (2002), *Ravage and Savage* (2000).
Starting the weekend with these in the CD changer: Boom Boom Satellites *Full of Elevating Pleasures,* Kid Rock & the Twisted Brown Trucker Band *'Live' Trucker* (great album cover by the way), Loudness *Rock Shocks* (or whatever it's called), Tania Maria with Boto and Hello *Via Brasil* (reissue), Nagg *Nagg.* I wonder which one will stay there the longest.
― xhuxk, Saturday, 11 March 2006 00:45 (twenty years ago)
― scott seward (scott seward), Saturday, 11 March 2006 00:48 (twenty years ago)
― scott seward (scott seward), Saturday, 11 March 2006 00:49 (twenty years ago)
― xhuxk, Saturday, 11 March 2006 01:48 (twenty years ago)
― xhuxk, Saturday, 11 March 2006 13:37 (twenty years ago)
― xhuxk, Saturday, 11 March 2006 15:14 (twenty years ago)
By the way, did I mention how much I like "Rocket Science," "Constanine's Sword," and "Change the World Henry" on the new Brain Surgeons album? I don't think so, but now I did.
― xhuxk, Saturday, 11 March 2006 16:55 (twenty years ago)
Let me guess, "Endless Sleep" on the Nagg album is the one you thought was most Quatro-like. Digital copies don't come with credits or lyrics, so I'm guessing.
― George 'the Animal' Steele, Saturday, 11 March 2006 17:28 (twenty years ago)
― xhuxk, Saturday, 11 March 2006 17:33 (twenty years ago)
― George 'the Animal' Steele, Saturday, 11 March 2006 17:58 (twenty years ago)
Beauty of the Bitch (Craig/Kinsley/Coates/Cashin)Endless Sleep (Nance/Reynolds)She's in Love With You (Chin/Chapman)So What If I Am? (Murray/Callander)We're Really Gonna Raise the Roof (Holder/Lea -- so Slade, obviously)Little Boy Sad (Walker)All I Need (Herrewig/Paliselli/Cooper/Cox)
And it is now back in my CD changer (replacing Juvenille, who I'll get around to eventually.)
― xhuxk, Saturday, 11 March 2006 18:05 (twenty years ago)
― xhuxk, Saturday, 11 March 2006 18:17 (twenty years ago)
Endless Sleep was some kind of rockabilly hit in the late Fifties. "So What If I Am" is a song by Paper Lace I never heard, PL being the "Billy Don't Be A Hero" single act.
― George 'the Animal' Steele, Saturday, 11 March 2006 18:34 (twenty years ago)
― xhuxk, Saturday, 11 March 2006 18:50 (twenty years ago)
― Ned Raggett (Ned), Saturday, 11 March 2006 18:58 (twenty years ago)
http://www.nagg.net/
The website is spare and effective. They've clearly no need for a publicist and are playing with BOC at some place in SF in April. Time to move Nagg debut album to greater recognition.
And "Beauty of the Bitch" was a B-side by the Liverpool Express in '77. Liverpool Express, I never heard of 'em, but here's what I found re Brit-land
In the 1970s, Liverpool Express scored several huge hits in the U.K. as well as across Europe and in South America. In fact, the group’s arrival in Brazil launched a bout of hysteria similar to the Beatles’ famed introduction to New York City. Yet, Liverpool Express never made it in America, and after three albums, the band called it quits.
The way the Nagg do it is thumping pop boogie sung by Bon Scott. Yep, the have to be collectors, or have someone with a real jones for finding cover choons for Amy Ward to sing the hell out of.
― George 'the Animal' Steele, Saturday, 11 March 2006 20:55 (twenty years ago)
http://www.nagg.net/nagg_pics8.htm
― George 'the Animal' Steele, Saturday, 11 March 2006 21:19 (twenty years ago)
ginger's *valor del corazon* is worth it for the guitars, too. it's basically a glam-rock singer-songwriter record, and the guy's a whizz at melodies. sometimes i wish his singing was more ian hunter, say, and less paul westerberg or dave grohl; he sings a little plain on most of this for my tastes, though that won't bother a lot of people. but i'd still call it closer to glam than powerpop. like, i don't think jesse malin ever made a record this good. when it gets totally singer-songwritery and self-pitying, like in "the man who cheated death," i get a little impatient, but usually the songs are way more rocking than that, and even the cuts i could do without are usually redeemed by great guitar or piano parts. "paramour," about how ginger wants to fuck his best friend's girl and by the end he wants to fuck his best friend too, is a great song. and the second disc (especially "drinking in the daytime," "my friend the enemy," "something to believe in") is more metal than the first. (19 songs total, which probably *could* have fit on one disc, so it's not *that* long.)
― xhuxk, Sunday, 12 March 2006 01:22 (twenty years ago)
― xhuxk, Sunday, 12 March 2006 01:34 (twenty years ago)
― xhuxk, Sunday, 12 March 2006 01:39 (twenty years ago)
> Saw The> Sword last night...who rocked by the way. I've been> trying to coin this phrase, "Hipster Metal" for the> past couple of months by telling everyone in the> industry that I know. So, being that it is Sat> morning and I am hungover, I figured I'd waste some> time defining it and trying to spread the word more.> Hell, my friend Megan (now GM of Sub Pop> ironically) was the one who coined the phrase> "Grunge" back in the day, so why not me here.> > Even though I don't meet these qualifications> below...I am definitely a fan of the genre> > HIPSTER METAL> > Qualifications for bands> 1. Your band sounds like Black Sabbath, but you> were born in the 80s> 2. You usually have 2 or 3 members (at least on> record)> 3. You have long instrumentals, or in some cases,> you don't even have a vocalist> 4. You reference vikings and wizards, but you are> not from Norway and don't wear facepaint> 5. You dress like you are homeless (and shave like> it also)> 6. You are selling original silkscreen posters for> every show you play> 7. Your only merch is 3/4 sleeve shirts> > Qualifications for fans> 1. see #5 above> 2. You stole your older brother's jean jacket and> tore off the big Iron Maiden patch on the back (and> probably tore off the sleeve)> 3. You bought the last > short-sleeve-button-down-snap-button-cowboy-shirt at the thrift store> 4. You live in Williamsburgh, Brooklyn and finally> got sick of listening to Interpol> 5. You are a hot chick (probably with tattoos)> 6. You think that Pabst is the best beer in the> world (out of a can only)> 7. You probably got beat up in junior high by kids> who actually listened to Black Sabbath> > Key Bands (basically the tracklisting for the> Kemado Records compilation "Invaders")> 1. 3 Inches Of Blood> 2. Big Business> 3. The Sword > 4. Dungen> 5. Witch> 6. The Fucking Champs> 7. Pelican> 8. High On Fire> 9. Witchcraft> 10. Comets On Fire> 11. Priestess> 12. Wolfmother> 13. Early Man
― Brian O'Neill (NYCNative), Sunday, 12 March 2006 14:59 (twenty years ago)
"so many times" on the nagg album reminds me of some pat benatar song ("you better run," maybe?)
and now (for reasons i may detail on the world music thread) that tania maria album is finally wearing on me.
hey scott, have you heard this rapider than horsepower split CD with mae-shi? who are mae-shi? they seem not bad, especially in the rap song that reminds of falco. unless that's rapider than horsepower; it's hard to tell with this thing. rapider than horsepower still sound like i always wish the pixies sounded but they didn't (i.e., more like 1980 pere ubu.)
― xhuxk, Sunday, 12 March 2006 15:28 (twenty years ago)
― scott seward (scott seward), Sunday, 12 March 2006 15:35 (twenty years ago)
4. You live in Williamsburgh, Brooklyn and finally> got sick of listening to Interpol
This is as good a reason as any.
― Ned Raggett (Ned), Sunday, 12 March 2006 15:39 (twenty years ago)
Interesting post, Brian.
Looks like another version of the hard rock for people who don't like hard rock meme which was discussed a lot in last year's rolling thread. People who don't like hard rock all suddenly go nuts over Early Man! The Sword! Wolfmother, for sure, right now. Dead Meadow were in there once, too.
Follow me-osis is one contributor. The hipsters read about some band in one of the big newspapers, like the New York Times sunday arts section, or the same with the LA Times, by writers who basically detest hard rock or metal, never listen to any of it that's all around them, get something heavily pushed by the indie p.r. company that pushes everything else they like to write about, and voila. Then you have the cliche of the great new hard rock or metal band: They alwayssounds like Black Sabbath (or Led Zep) because that's the only big hard rock / metal band the writer has even vaguely heard of, and it'll be packaged with some version of the cliche that this new hard rock / metal band isn't as stupid as all the rest of 'em or is a new kind of metal food, packed with intellectual goodness of some kind. Sometimes you'll see an old band invoked in connection, too, with the "old" bandbeing one that has attained a critical/namecheck cachet all out of proportion to the number of people who actually listen to them, in this case, you look for keywords like Sir Lord Baltimore, or, it hurts to mention it, The Groundhogs.
I went off on Early Man last year because they were a two-man act, on Matador and peddled in this way. And after listening I actually felt they were legit. The album wasn't one of my faves of the year but the song "Death Is the Answer" sure was. So far, it does look to me like Early Man is not getting traction outside of the hard rock for people who don't like hard rock slice. A shame, because the band is better than that.
I'd put Pearls 'n' Brass in the same category. It has as much to do with the way the band has been peddled. All the press has been fairly lickspittle and from the same manner of sources that usually shillthe hard rock for people who don't like hard rock choices. (Citay is another current example.)
LA Times is a great barometer for pegging the demographic. If a band gets mentioned by one of their critics in a club date review or column on buzz bands as some new hot hard rock thing, it's hard rock for people who don't like hard rock.
Good bands can fall into it by accident, by dint of being peddled by p.r. agencies and/or indie labels with some juice that normally don't have anything to do with hard rock or metal. Girlie, for example, is one agency with good success at placing acts and infrequently is found pitching acts in this area.
People who like to listen to it never seem to realize that classic hard rock and metal never goes away. Or that there is certainly no shortage of fair to good stuff. They just don't see it -- so a band that's pushed comes at them like novelty. And they don't know of the great number of bands because they don't sift cd baby for vanity pressings or other type places that stockpile loads of the stuff.
If I were in a band in this demography, and I were pretty cold-eyed in our chances, I'd be alarmed at being in because it means you're getting a kind of momentary artificial buzz that's (1), not going to last long and (2), in all likelihood won't break you through to the kind of sales that will take you to the next level.
― George 'the Animal' Steele, Sunday, 12 March 2006 16:31 (twenty years ago)
― scott seward (scott seward), Sunday, 12 March 2006 16:42 (twenty years ago)
J Mascis from Dinosaur Jr's new band. Played the CD, somehow thinking it was Witchcraft, and couldn't figure out why it was going in one ear and out the other. Then I figured it out.
― xhuxk, Sunday, 12 March 2006 16:42 (twenty years ago)
Authenticity, whatever it actually is, has never been high on my list for enjoying something. It just has to sound good to me.
Do teh hipsters like or think they like authenticity. I guess if they're drinking Pabst, it's a badge of authenticity, also like drinking Yuengling, the latter of which is super authentic?
and i do think that kelefa and some others there ARE actual fans of metal
Bosh.
― George 'the Animal' Steele, Sunday, 12 March 2006 16:44 (twenty years ago)
― Ned Raggett (Ned), Sunday, 12 March 2006 16:46 (twenty years ago)
http://www.decibelmagazine.com/forum/comments.php?DiscussionID=137&page=1#Item_0
and lotsa love for early man & the sword on the decibel forum:
http://www.decibelmagazine.com/forum/comments.php?DiscussionID=118&page=1#Item_0
― scott seward (scott seward), Sunday, 12 March 2006 16:49 (twenty years ago)
i don't think it is. kelefa has been writing up metal shows and albums since he got to the times, and something tells me the times wouldn't lose any sleep if he never wrote about metal. granted, he's more of an emo-metal lover, but still...
― scott seward (scott seward), Sunday, 12 March 2006 16:57 (twenty years ago)
How did Cheeseburger get left out?? Wasn't Cheeseburger a Kemado act? Not fair, Cheeseburger left in non-hipster Hell.
Black/white; red/green. NY Times arts has always been one of my barometers for people who don't like hard rock. I know you dig 'em. There honor is defended plenty.
― George 'the Animal' Steele, Sunday, 12 March 2006 17:03 (twenty years ago)
― scott seward (scott seward), Sunday, 12 March 2006 17:33 (twenty years ago)
― scott seward (scott seward), Sunday, 12 March 2006 17:34 (twenty years ago)
The Pabst drinkers and one disbeliever check in! Lead off with the PR Newswire announcement of cruciality.=========
Here's the most crucial news about this group that's had the kidshollering and the press gushing following their recent sold-out tour of theStates and the release of their Modular/Interscope EP, Dimensions. For starters, the NME has dubbed Wolfmother "Australia's Best New Band"while UK broadcaster Zane Lowe recently featured them as "Best Record In TheWorld" on his influential BBC radio show. Here in the States, the Sydney based trio just landed a high-profilefeature on MTV's influential You Heard It First program plus a full pagefeature in the Sunday edition of the Los Angeles Times that declared them"sexy, liberating, exciting and raw." Both of these acts of praise followmassively packed sold-out shows earlier this month in New York and LosAngeles.
-- PR Newswire
Sometime during hours of jamming, the trio discovered a means to free themselves through overblown, heavy-riffing 1970s-style rock a la The Who or Pink Floyd, with a heavy slab of Black Sabbath tossed in.
The National Post
Wolfmother, "Wolfmother" (Modular) Black Sabbath comparisons are inevitable with this young Australian trio's debut: The drums are huge, and the guitars are even bigger. While Myles Heskett, Chris Ross or Andrew Stockdale aren't quite Ozzy, that's more a treat than a downer.
-- Denver Post
This packs the cliches
Even better that Ross, guitarist/vocalist Andrew Stockdale, and drummer Myles Heskett have assumed the classic rock-power triad formation. Like Cream. Or the Jimi Hendrix Experience. Or Blue Cheer. But unlike the Spiccoli Army that came before them (the Nebulas, the Fu Manchus, the Atomic Bitchwaxes), Wolfmother avoid many of the pitfalls of what has become an essentially Californian idiom (the overextended jam freak-outs; the calls for gas, grass, or ass; the name "Atomic Bitchwax"), by taking the music back to where it all began: Sabbath and Zeppelin, duh—emphasis on the Sabbath. "As an angsty teenager, I wanted dark riffs and dark lyrics, and that's what Sabbath did for me," Ross explains. "I didn't really understand Led Zeppelin as much. There's a lot of big hair being thrown about."
-- The Stranger
Hah.
Channeling the same influences as a million or so previous go-nowhere high-school garage acts, primarily the hard-rock and primordial metal of Led Zepplin, Iron Butterfly and Black Sabbath, Wolfmother makes its stateside debut with a four-song EP that eliminates the last threads of invention and creativity from the revivalist formula to settle into a format that unabashedly recreates its influences. Wolfmother panders a highly studied, if totally generic, amalgam of '70s hard rock that's not afraid to blatantly repackage and resell its influences without ever retooling them.
...Mind's Eye gives the band over to an Amboy Dukes-meets-Sabbath vibe that could easily be matched by any senior-year stoner with a basement amp. 'Love Train' and the title track revert to dazed-and-confused Zeppelin psycho-blues as Stockdale does that annoying Ozzy impersonation. All in all, it's the record just about every uninspired 19-year-old burnout has in them.
-- Aversion
This trio from Sydney combines the fuzzed-out bass of Black Sabbath with the fury of ’60s garage rock to create a throwback to the old days of rock when conversion vans and AM radio ruled.
-- Pitt Press from the University of Pittsburgh
Wolfmother: Wolfmother are another act from down under. Attempting a sound that is more classic rock oriented. However classic rock, it’s a sincere effort and not a henious nostolgia gimmick band. The group are fresh from winning Austrailia’s J Award, for “Best Album.” However, you won’t be able to get their new album at Target or Wal-Mart; it’s been removed because their album artwork has a nude woman (shock!).The point is, if you’re interested in Led Zepplin and Cream and all that stuff, check out Wolfmother.
-- The Bard Observer
On Presidents' Day, we are going to exercise our executive power to tell you what shows to go see. Here's our vision of the state of the rock 'n' roll union this week:
wolfmother.jpgTonight Gothamist will be at the Mercury Lounge, grooving to Australian band Wolfmother's heavy, heady mix of Queens of the Stone Age psychedelia and White Stripes rawk.
-- The Gothamist
― George 'the Animal' Steele, Sunday, 12 March 2006 17:47 (twenty years ago)
― scott seward (scott seward), Sunday, 12 March 2006 18:04 (twenty years ago)
― Ned Raggett (Ned), Sunday, 12 March 2006 18:07 (twenty years ago)
― scott seward (scott seward), Sunday, 12 March 2006 18:16 (twenty years ago)
WHO GIVES A FUCK ABOUT WHAT SORT OF PEOPLE LISTEN TO BANDS.
massive xpost.
― Last Of The Famous International Pfunkboys (Kerr), Sunday, 12 March 2006 18:28 (twenty years ago)
Didn't he actually used to play in hardcore bands in Massechusetts? Or did I imagine that?
― xhuxk, Sunday, 12 March 2006 18:35 (twenty years ago)
― Edward III (edward iii), Sunday, 12 March 2006 18:39 (twenty years ago)
http://www.myspace.com/cjsleez
― Ned Raggett (Ned), Sunday, 12 March 2006 19:04 (twenty years ago)
So is "Change the World Henry" on the Brain Surgeons album about Henry Kissinger (when it's not about "Eric Burdon and the Animals band," I mean)? Also, cool flamenco-metal ending in "Strange Like Me."
― xhuxk, Sunday, 12 March 2006 19:19 (twenty years ago)
http://www.flickr.com/photos/thebunnybrains/
― scott seward (scott seward), Sunday, 12 March 2006 19:43 (twenty years ago)
― Ned Raggett (Ned), Sunday, 12 March 2006 19:45 (twenty years ago)
― scott seward (scott seward), Sunday, 12 March 2006 19:57 (twenty years ago)
CJ Sleez -- Canadian (from Hamilton or Edmonton, one of the 'tons) chick doing the motorcycle dominatrix in leathers thing. She's so tuff she'll ram ya with a strap-on while she's chewing your ear off. Anyway, everyone knows the shtick but sometimes it works, anyway, because if you do what you know and you know it fair to good, then you'll at least sound committed. So her EP, Back from the Brink has six songs and she puts the worst two first. Just when I was ready to take it off, the boringly titled "Skin Deep" comes along and rips a new hole in thee and a half minutes. Maybe this EP was recorded almost live in the studio because now it's 6 minutes in and the band is beginning to put a trench in the asphalt. Next three songs -- 'til the end -- are good, too. Can't tell what CJ is "singin'" about because she doesn't "sing" -- she snarls and hurls what sound like strings of imprecations and abjurations only you've no way of telling what they are. Plus it's an EP and it's over in 19 minutes which is great for this type of material. More people should do it instead of the couple nuggets of gold smothered in a five pound bag of sand thing that's the normal practice. CJ probably plays the bars a lot.
Much different than Nagg, CJ's definitely toward the Motorhead side of things. There was a good deal of local press on her webpage and she's not at all tough on the eyes. For fans of Wendy O. when she went straight metal, CJ "sings" a lot better.
I would've missed the pics in the Times if Scott hadn't mentioned it. Devendra Banhart in a dress, ain't that surprising. Actually, the photos reminded me of old Hawkwind, or Tull or Edgar Broughton Band pictures. Like the good ol' days when the New York Times wasn't interested in the subject, always pretending to be hip, and making up stories about everything from how thugs employed as bouncers at NY clubs aren't thugs anymore, but cool, and how the coming model for upscale housing development in soCal will be Mexican shantytowns, rather than the real slum shantytown that's along the highway between Glendale and Sherman Oaks that it already is. I think I read both of them today.
― George 'the Animal' Steele, Sunday, 12 March 2006 20:15 (twenty years ago)
And yeah, I took the Style section (along with other sections) to the Irish off-track-betting bar/restaurant down the street (St Patrick's Day's on FRIDAY this year -- Sunnyside is going to explode, I swear) to eat nova benedict (= eggs benedict with salmon instead of canadian bacon) this morning, and didn't even notice scott's bro then. (Oh wait, I get it -- he's in the "T" magazine or whatever it's called, not the Style section per se. I see it now. At first I wondered if he was wearing birkenstocks or in a fishing boat with James McMurtry.)
― xhuxk, Sunday, 12 March 2006 20:38 (twenty years ago)
Ah nice.
if anybody cares. I can't be the only Wildhearts fan on this thread, can I?
Nope!
― Ned Raggett (Ned), Sunday, 12 March 2006 20:39 (twenty years ago)
On the same label there's a band called Puff. Puff I know nothing about. Puff and Phluph. And Chamealeon Choir, which had Chevy Chase before he was famous, in it. And I'm sure Chamaeleon Choir aren't hard at all and don't belong here.
St Patrick's Day's on FRIDAY this year -- Sunnyside is going to explode, I swear)
Last week the Times had another piece of fiction in the Sunday edition. Anyway, it looked like fiction. It said all the Irish were moving back to Ireland.
― George 'the Animal' Steele, Sunday, 12 March 2006 20:39 (twenty years ago)
Nope. I saw them 4 or 5 times way back. A great band.
― Last Of The Famous International Pfunkboys (Kerr), Sunday, 12 March 2006 20:44 (twenty years ago)
Economy's allegedly doing much better (though when I was there most of the ILX crew were noncommittal) and all the Catholic hierarchy types that Joyce was none too fond of have had their stature much reduced over the last couple of decades. Still I admit I'd prefer more sun.
― Ned Raggett (Ned), Sunday, 12 March 2006 20:45 (twenty years ago)
― JayBabcock (jabbercocky), Sunday, 12 March 2006 20:53 (twenty years ago)
OTM
― Last Of The Famous International Pfunkboys (Kerr), Sunday, 12 March 2006 20:58 (twenty years ago)
Where were you?
Listening to Tokyo Dragons or Derin Dow, one or the other.
Now then, CJ Sleez in Rock Action!! photos. I'm fond of the one with the BB stuck in her upper lip. http://www.babak.ca/backstage/Rock/Cj%20Sleez.html
― George 'the Animal' Steele, Sunday, 12 March 2006 21:07 (twenty years ago)
I thought everyone looked pretty good. Black and white served them well.
― George 'the Animal' Steele, Sunday, 12 March 2006 21:15 (twenty years ago)
― JayBabcock (jabbercocky), Sunday, 12 March 2006 21:20 (twenty years ago)
― George 'the Animal' Steele, Sunday, 12 March 2006 21:27 (twenty years ago)
I still don't think I've heard a note of Pearls & Brass (odd, since I THINK Drag City still sends me stuff. New Red Krayola CD's a bore; Espers is pretty. But If I got P&B, I sure never noticed.)
― xhuxk, Sunday, 12 March 2006 21:42 (twenty years ago)
― JayBabcock (jabbercocky), Sunday, 12 March 2006 21:51 (twenty years ago)
Said on the CD Baby page they're an NYC band? And the singer was from Wench, an act I sort of remember liking as a thrash metal act in NYC or Jersey (?) about ten years ago?
― George 'the Animal' Steele, Sunday, 12 March 2006 21:58 (twenty years ago)
I do indeed! Haven't played it in a while though. I remember liking a few tracks on it. I dig that Chevy Chase album too, but it ain't heavy. light as a feather psych-pop.
I am, for the record, a Wildhearts fan too.
― scott seward (scott seward), Sunday, 12 March 2006 22:05 (twenty years ago)
― scott seward (scott seward), Sunday, 12 March 2006 22:12 (twenty years ago)
― George 'the Animal' Steele, Sunday, 12 March 2006 22:20 (twenty years ago)
― pdf (Phil Freeman), Sunday, 12 March 2006 23:15 (twenty years ago)
-- "G.T.T." is an incredibly funky big-beat drum-program and slap-bass (and other stuff) instrumental, with some incidental talking on top. How funky? Well, let's just say I had the Ginger CD on random mix with Juvenile, among other things, and I was kind of shocked that Juvenile could come up with a track so funky and rocking. But he didn't. (I thought it might be a tribute to old-school New Orleans r&b) Well, maybe he HAS, but it wasn't him.
-- "Mother City" is a very moving ode to New York sung from the point of view of a kid who grew up there, saw Spiderman near a trashcan when he was six, and was the only kid in his school to discover the Ramones, Dolls, and Kiss. Should be totally corny in that new-york-rock-history-who-gives-a-shit-let's-put-CBGB-out-of-it-halfassed-misery-already kinda way, and maybe it is, but it still works. Ends with "woagh-yeahs" out of "Lonely Planet Boy" (and hence maybe the most BLATANT glam reference on the album, but isn't Ginger British? Or did he live in NYC at some point? Maybe he just a good imagination.)
― xhuxk, Monday, 13 March 2006 01:17 (twenty years ago)
― Last Of The Famous International Pfunkboys (Kerr), Monday, 13 March 2006 01:26 (twenty years ago)
― xhuxk, Monday, 13 March 2006 14:07 (twenty years ago)
http://cdbaby.com/cd/hoprozac5
And Exciter's Violence & Force has come to eMusic.
― George 'the Animal' Steele, Monday, 13 March 2006 22:34 (twenty years ago)
"The Children of Numbers greet the battlefield as a playground, their beards and ringlets flowing strong from the master root of the Elder forest," writes Ian on the back.
― George 'the Animal' Steele, Tuesday, 14 March 2006 22:58 (twenty years ago)
"What makes this band so good — on its second album, "The Indian Tower" (Drag City), and in its show at Cakeshop on Saturday night — is that its musicians have thought a lot about song structure, but even more about groove. The concentration on that groove by its three members — Randy Huth on guitar, Joel Winter on bass and Josh Martin on drums — means that the band can get rhythmically tricky in its theme riffs, swinging asymmetrically between two- and three-beat patterns, but you don't much notice it. The vocal lines sail right through these rhythmic shifts, the music's heavy bottom end never alters, and it all feels like one unfolding pattern."
― JayBabcock (jabbercocky), Wednesday, 15 March 2006 02:51 (twenty years ago)
Fucking Champs are still like xhuck said upstream: I guess the idea was that if you learn some Iron Maiden or Queen guitar riffs and randomly string them together you don't need to have any songs.
It's not enough and I heard a good Queen riff for a few bits in there.
Night After Night and Warhammer 48 were good old conventional poverty metal. Parchman Farm ended it on a funky note and when people claim Wolfmother sound LZ or Black Sabbath, I didn't hear any of that in "Love Train."
Diamond Nights and Witch featured singers sounding like children. Itwas OK in the former, not in the latter, where it comes off as a calculating joke. Diamond Nights didn't sound like they were joking.
And Dungen offered an instrumental that sounded like early Jethro Tull in a jam room. High on Fire made many of the other bands bracketing them sound weak, Bug Business had a terrible "singer" and Danava sounded like they were trying to be ambitious and epic in an old prog metal way. Danava's cut sounded like a demo but the trashy tone made it stick out to their benefit.
― George 'the Animal' Steele, Wednesday, 15 March 2006 03:14 (twenty years ago)
Anyone who lives in NYC and can go out to a show tonight (I can't!), check out this all-female metal band from Long Island called Dormitory Effect and let me know how they are. They play at midnight at Arlene's (Wednesday). I haven't heard much--on their MySpace page, two songs play at the same time when I try and listen--but they apparently have a debut EP out and from what I can tell they might be pretty good. Their former bands are Perseverance, One Step Beyond, and Sympathetic Magic, none of whom are familiar to me.
― Helen Keller, Wednesday, 15 March 2006 14:18 (twenty years ago)
― baby, disco is fuck (yournullfame), Wednesday, 15 March 2006 14:25 (twenty years ago)
If you liked Discouraged Ones, then I would suggest that you just go in order and pick up *Tonight's Decision* next. A great album. Maybe not the masterpiece that Discouraged Ones is, but close. If you like that, which you probably will, then get Last Fair Deal Gone Down, and then Viva Emptiness. The new album is good too. Sounds like Viva Emptiness a bit, maybe a little heavier. If you don't have a problem with death vocals, then by all means get *Brave Murder Day*, an album that is doomy greatness and which also kind of set the stage for Discouraged Ones. Mikael Akerfeldt of Opeth did the vocals on that one. Their first album, made when they were just kiddies, *Dance Of December Souls* is great doom metal if you can find it. But I would go with *Tonight's Decision* first.
― scott seward (scott seward), Wednesday, 15 March 2006 15:20 (twenty years ago)
― scott seward (scott seward), Wednesday, 15 March 2006 15:33 (twenty years ago)
― scott seward (scott seward), Wednesday, 15 March 2006 15:41 (twenty years ago)
― Helen Keller (Helen Keller), Wednesday, 15 March 2006 16:14 (twenty years ago)
― scott seward (scott seward), Wednesday, 15 March 2006 16:34 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 15 March 2006 16:57 (twenty years ago)
― scott seward (scott seward), Wednesday, 15 March 2006 17:48 (twenty years ago)
http://youtube.com/watch?v=r3qGAuqMIMI&search=katatonia
― scott seward (scott seward), Wednesday, 15 March 2006 17:51 (twenty years ago)
― scott seward (scott seward), Wednesday, 15 March 2006 18:03 (twenty years ago)
― Helen Keller (Helen Keller), Wednesday, 15 March 2006 19:07 (twenty years ago)
x-post - he's a cutey, isn't he!
― scott seward (scott seward), Wednesday, 15 March 2006 19:09 (twenty years ago)
― James Slone (Freon Trotsky), Wednesday, 15 March 2006 20:07 (twenty years ago)
65% of what I listen to is doom metal and I just call it doom, with perhaps an adjective thrown in like gloomy, morose, plodding, despressive, whiny, psychedelic, or trancy. Distorted vocals are so common in metal now that the "death" element in "doom death" isn't really necessary to draw attention to. I actually call Katantonia, Day Light Dies, Rapture, and October Tide "Katatonia school" doom, since all these bands/projects basically sound like (or at least did) variations of Katatonia.
― James Slone (Freon Trotsky), Wednesday, 15 March 2006 20:13 (twenty years ago)
― James Slone (Freon Trotsky), Wednesday, 15 March 2006 20:16 (twenty years ago)
― scott seward (scott seward), Wednesday, 15 March 2006 21:25 (twenty years ago)
― xhuxk, Wednesday, 15 March 2006 21:33 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 15 March 2006 21:36 (twenty years ago)
===The Rambler is a modified 1980 Chevy G30 box van; it's a moving stage with a tricked-out sound system. The Rambler has leopard-print seat cushions, lovely fake wood paneling and a disco ball inside.
It's completely D.I.Y., rock 'n' roll on wheels.
But while rockers through the ages might have kicked around similar ideas, it is the "life's work" of San Francisco native and longtime musician Tina Gordon to actually realize the dream. After a successful run around San Francisco this fall, she's taking three metal/hard rock bands -- Night After Night, Walken and Hightower -- to South by Southwest to play three days of renegade shows next week.
With the Rambler, after all, you don't need to apply, pay fees and wait in line to get your 15 minutes of fame with the 1,400 other bands scheduled to perform at the monster Austin music and film festival. After securing the blessing of a local bar Ms. Bea's, a Tejano bar with a large patio, the Rambler will roll up and start rocking two blocks away from the heart of the festival.
"I got the concept six years ago, when San Francisco music culture was deteriorating, in serious decline," says Gordon, clad in a faded T-shirt and jeans. She's a small person with a big presence, as befitting someone who's been holding her own in the dude-heavy heavy rock community for the better part of a decade (she's been playing drums in bands for 13 years). Currently, she's the drummer for metal outfit Night After Night and all-female AC/DC cover band, AC/DShe and plays guitar for the Glamour Pussies. "People were being evicted from practice spaces, clubs were closing down. It was awful. There were, seriously, like, two places to play music in the city," she says, swinging her hair over her shoulder, "and nowhere for metal. There were no assurances that there would be shows to play."
It was this time, during the boom, that Gordon started kicking around the idea of a self-contained "mobile rock unit." "It was more of a gesture, though, a joke," Gordon says, until a little over two years ago, when Gordon acquired the Chevy box van that is the body of the Rambler.
"I wasn't sure what I wanted to do at that point," Gordon says. "It wasn't the same statement any more."
But the Rambler (as it was now called) found its purpose in a music project: the Rambler Twelve Hour Composition.
Gordon got a grant from the San Francisco Arts Commission to perform a composition based on music she'd been writing for the past five years. Based around the number of beats per minute in her songwriting, she put together a show that would be performed from sun up to sun down on the autumnal equinox (which fell on Sept. 22). She enlisted 36 musicians to perform at different locations throughout the day. "It went off killer," she says, as two other performers, Jake Japanese from Hightower and Andy Headrick from Walken, nod in affirmation.
The deadline, like all deadlines, provided the compulsion to finish the Rambler. It wasn't easy; there are no blueprints for making a box van into a mobile rock unit. She characterizes the process as "trial and error, with lots of crying."
"Luckily, every member of Night After Night besides me is a carpenter," says Gordon, laughing. Bandmate Eric Peterson designed the iron-based frame that allows the stage to roll out on castors, and then roll back in -- like drawers. On both sides of the stage there are wings, which also roll out. Many other friends helped -- from welder Diane Coopersmith, who was on hand, measuring the wheel base to add some racing stripes to bandmate Joe Oberjat acting as the electrical engineer. The Rambler was built in the parking lot at San Francisco practice space Secret Studios, through an arrangement with the supportive studio owner.
"The focus on sound quality sets the Rambler apart," says Brooklyn veteran indie music organizer Todd P, who has helped book the shadow music festival at Ms. Bea's with the Rambler crew.
"Punk shows, having underground shows at unlikely venues, usually means really poor sound quality. The Rambler seems to have done its thing with a caring and artistic eye," Todd says in a phone interview, noting that he actually hasn't seen the vehicle, only heard about it, "and that usually only comes with lots of money, not as a portable creation or open to the public."
What the Rambler has on board in terms of sound equipment is impressive: amplifiers and their cabinets mounted to stage, a PA system, electrical outlets galore, a DAT recorder in the van to record all performances. "It's better than most clubs," says Japanese, perched on the edge of the carpeted stage.
"When we have a full crew, we can get the set-up down to 10 minutes," Gordon says.
While Gordon wanted to be clear that she bore SXSW no ill will, others were less charitable. "It used to be that you went to SXSW if you were looking to have a label," Japanese says. "Now, you can only go if you're already on a label. The whole thing's changed."
There are quite a few bands attending the festival hoping for industry attention -- and none of the bands on the Rambler said they'd put up much of a fight if someone wanted to sign them -- but the Rambler's m.o. is clearly to upend the traditional touring apparatus.
― George 'the Animal' Steele, Wednesday, 15 March 2006 22:28 (twenty years ago)
― Brian O'Neill (NYCNative), Wednesday, 15 March 2006 23:16 (twenty years ago)
― Brian O'Neill (NYCNative), Wednesday, 15 March 2006 23:17 (twenty years ago)
A band that came before funeral doom but pretty much laid the groundwork was Disembowelment. Of course they pushed the ambiance beyond funeral parlor into more ethno-ambient terrain, but their releases defintiely have an eerie blackened feel and slow dirgy tempos.
― James Slone (Freon Trotsky), Thursday, 16 March 2006 01:12 (twenty years ago)
It is Everylovely Lightningheart, and it is playing now (at home). "Cusp," an infinitely long single on Hydra Head. New age ambient sludge dirge drone, no song, no tune, no rocking, not especially memorable when it's not actually playing, but very useful for reading or sleeping too when life has become way too stressful. As is that new Om CD, which I played at work. As was their first one. As was the CD called *Namaste* by the Electronica En Espanol band also called Om that came my way in the mid '90s, before the metal guys.
― Helen Keller (Helen Keller), Thursday, 16 March 2006 01:23 (twenty years ago)
― xhuxk (Helen Keller), Thursday, 16 March 2006 01:25 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 01:33 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 01:47 (twenty years ago)
I haven't watched the accompanying DVD yet. Thet must be a hoot.
― Brian O'Neill (NYCNative), Thursday, 16 March 2006 01:50 (twenty years ago)
― pdf (Phil Freeman), Thursday, 16 March 2006 02:08 (twenty years ago)
i still haven't listened to the new album by tim "ripper" owens and his band, Beyond Fear. i don't have the highest of hopes.
― scott seward (scott seward), Thursday, 16 March 2006 02:17 (twenty years ago)
http://www.decibelmagazine.com/features/april2006/glenbenton.aspx
― scott seward (scott seward), Thursday, 16 March 2006 02:24 (twenty years ago)
Sounds like you’ve got a lot on your plate, man.
Yeah, man, my life is nothing but drama lately. But it’s after five o’clock, so I don’t think I’m gonna get served with any kind of restraining order today—but I’ve got my truck loaded up with everything just in case, because when they do serve one on you, they usually tell you you’ve got like 15 minutes. At least if I’ve got all my paperwork, I can go to court and… Oh, fuck, dude. Here comes the sheriff. You done with me? I got the sheriff’s department here.
― scott seward (scott seward), Thursday, 16 March 2006 02:26 (twenty years ago)
nope, can't be - this one turns out to last a mere *40* minutes!
― xhuxk, Thursday, 16 March 2006 04:23 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 13:52 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 14:03 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 14:14 (twenty years ago)
― blackmail (blackmail.is.my.life), Thursday, 16 March 2006 14:26 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 14:33 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 14:38 (twenty years ago)
http://www.youtube.com/watch?v=pq5hWFjO_W4&search=captain%20beyond
― scott seward (scott seward), Thursday, 16 March 2006 14:40 (twenty years ago)
― blackmail (blackmail.is.my.life), Thursday, 16 March 2006 14:45 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 15:44 (twenty years ago)
Little whizz kid mystified me, she was a New York City beatShe came on flash - monster mash, motors in her feetNow we moved out of Manhattan to her home on the Brooklyn HeightsHer dad's a street punk and her mum's a drunk, but we made out alrightFar far from home, oh I felt so aloneCould not spin to the speed of the cityOh send me my ticket, I'm too scared to stickWith my little whizz kid - such a pityNow she really tried her hardest just to make me leave the bandShe even hired a toy "rent-a-boy" straight from a Times Square standOh thank you little whizz kid, but me and my friends gotta eatSo get back to school or the tying pool, just get yourself out on thestreet
― xhuxk, Thursday, 16 March 2006 16:01 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 16:21 (twenty years ago)
― xhuxk, Thursday, 16 March 2006 16:41 (twenty years ago)
I was amazed at how good that album is. And I'm not the biggest black metal fan.
― a. begrand (a begrand), Thursday, 16 March 2006 18:52 (twenty years ago)
I don't like black metal at all apart from weaklings and that lurker of chalice album but this album is really great. Don't know anything about them though.
― Brigadier Lethbridge-Pfunkboy (Kerr), Thursday, 16 March 2006 19:21 (twenty years ago)
more info: http://www.crionicmind.org/bindrune/pages/index_two.html
― scott seward (scott seward), Thursday, 16 March 2006 20:51 (twenty years ago)
That was pretty swanke. Thanks!
― James Slone (Freon Trotsky), Thursday, 16 March 2006 23:20 (twenty years ago)
That was pretty swank. Thanks!
― Brigadier Lethbridge-Pfunkboy (Kerr), Thursday, 16 March 2006 23:27 (twenty years ago)
Not bad.
― James Slone (Freon Trotsky), Thursday, 16 March 2006 23:28 (twenty years ago)
I got the promo in the store and will listen.
Re: "Hipster Metal"
The term is not used but in the new edition of Magnet they instead call it "Indie Metal" (which I like far less) in an article that goes out of its way to point out that the bands they included are Magnet-approved metal, with quotes from the bands that also steer things in that direction.
The bands profiled: Early Man, The Sword, Pearls And Brass, Goblin Cock, Rosetta and Torche.
There's also a sidebar whose subhead is "Five Must-Have Modern Metal LPs" that does smallish reviews of Katatonia's Last Fair Deal Gone Down, the eponymous discs from Mare and Witchcraft, and the last discs from Gospel and Kylesa.
Finally, in the midst of this, Eagles Of Death Metal’s Jesse Hughes details his favorite heavy albums. They include The Sonics Boom, Sabbath's Vol. 4, QOTSA's R and... Aladdin Sane from Bowie.
The rest of the issue does a good job at completely avoiding anything remotely heavy outside of Mudhoney, who did get a lot of metal press back in the '80s. So metal is officially noted and succinctly ghettoized.
― Brian O'Neill (NYCNative), Friday, 17 March 2006 01:51 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 17 March 2006 01:53 (twenty years ago)
they have obviously been reading me on ilm. er, at least where katatonia, gospel, and kylesa are concerned. they should follow my lead more often. it can only help their mag. the kylesa album, which i think i voted for in the pazz & jop, was written up in the new york times as one of those "you may have missed it" kinda things at the end of the year.
― scott seward (scott seward), Friday, 17 March 2006 02:10 (twenty years ago)
― Brian O'Neill (NYCNative), Friday, 17 March 2006 02:46 (twenty years ago)
And Wolfmother is still doing nothing for me.
― George 'the Animal' Steele, Friday, 17 March 2006 03:33 (twenty years ago)
― George 'the Animal' Steele, Friday, 17 March 2006 06:26 (twenty years ago)
― xhuxk, Friday, 17 March 2006 16:14 (twenty years ago)
Back to Mott the Hoople. That band could actually do a reunion. No one died. (Except for Mick Ronson and he wasn't in the band long before it flew apart for good.) If I have to have Queen & Paul Rogers on PBS TV, I can't understand why no Mott the Hoople somewhere.
― George 'the Animal' Steele, Friday, 17 March 2006 16:29 (twenty years ago)
Also top of the playlist this weekend: Huck Johns, Detroit transplant to LA who google seems to suggest turned down a Velvet Revolver opening slot at least once. Looks like Tim McGraw to me, though I'm guessing he gave a lot more thought to picking his truckers hat and those Fleetwood Mac and Muddy Waters albums on the couch on the CD's back cover than Tim might give to more apparel choices. I won't hold that against him though. Album very much rocks, even the grunge parts, but especially maybe the tributes to "Highway to Hell" and ELO's "Turn to Stone", and the Seger "Ramblin Gamblin Man" cover and maybe more. (Which reminds me I need to get back to that live Kid Rock album soon too.) (Pretty funny too that Huck's Capitol Records subsidiary is called Hideout, same name as Seger and the Last Heard's label from Persecution Smith/East Side Story/Heavy Music daze.)
― xhuxk, Saturday, 18 March 2006 00:57 (twenty years ago)
― xhuxk, Saturday, 18 March 2006 01:41 (twenty years ago)
― Thomas Tallis (Tommy), Saturday, 18 March 2006 02:28 (twenty years ago)
Huck Johns is sounding better and better. Turns out he's apparently from Lincoln Park, MI, and wrote a song for Kid Rock once, though I didn't know that when I put them in the same paragraph up above. Album is basically mostly '70s Ford assembly line singer-songwriter hard rock; the "grunge" I refer to above has to do with ballads that remind me somehow of Stone Temple Pilots, one of one which, "One Good Man" (which I guess doesn't remind *that* much of STP) may have a possible gay undercurrent, given that Huck's searching for one good man in it. In his liner notes Huck thanks not only eternal Detroit AOR station WRIF and Seger but also Johnny "Bee" Badanjek of Rockets/Ryder fame, and the producer is one Arthur Pennhallow Jr--interesting, since I swear I remember a guy named Arthur Penhallow being a longtime DJ on late '70s/early '80s Detroit rock stations. So now I'm wondering if Huck's some kind of local Michigan hit. Weird that the CD's on Capitol, given that it seems to have way more in common to what you'd find via cdbaby.
> Jordan Zadarozny... [made] me a mix CD == he called it *A Chi's Life*...a compilation of the kind of metal stuff a hicktown Canadian hesher would've grown up on<Found it; here's the track list:
Thin Lizzy - SitamoiaAC/DC - Downpayment BluesMotorhead - No ClassThin Lizzy - Little DarlingMax Webster - HangoverMax Webster - Paradise SkiesAerosmith - Heart's Done TimeGuess Who - No TimeKiss - Goin' BlindQueen - Sheer Heart AttackAerosmith - Lick and a PromiseAerosmith - Sick as a DogDavid Wilcox - Hot PapaDavid Wilcox - BearcatMasters of Reality - Deraldina's PropheciesThin Lizzy - Little Girl in Bloom
― xhuxk, Saturday, 18 March 2006 17:23 (twenty years ago)
Listening to Hazard County Girls a New Orleans all-chick art-sludge trio somehow associated with ex White Zombie bassist Sean Yseult (whose own current/recent metalbilly pyscho-garage band Rock City Morgue I like a lot) is making me theorize that one thing that annoyed me about the Melvins was that, not only did they slow Sabbath music down (a cute novelty for about ten minutes when their first album came out on Alchemy around 1985 or whatever year that was), but they apparently flushed Sabbath's groove down the toilet, too. Not that I feel like pulling out any Melvins CDs and verifying said theory. All I know is that Hazard County Girls' Sabbness is grooveless, and I keep thinking "they sound a lot like the Melvins." Also HCC have a pretty lame singer, sounding way too introverted.
Kill Cheerleader allegedly have fans in Lemmy and sundry Motley Crue members and they've opened for Judas Priest. They're totally catchy (rockingest songs so far "So Young" and"Deathboy"), and often suprisingly heavy (eg "Bad Habit") for what I'm about to say but they also keep making me think "they sound like one of those Swedish garage bands from the past few years, I just can't place which one." Hopefully it's the Nomads, but it's also possible they sound like a missing link between the Hives and Turbonegro, I'm not sure. Though my gut feeling right now is that they're *better* than the Hives or Turbonegro.
― xhuxk, Saturday, 18 March 2006 23:36 (twenty years ago)
― xhuxk, Saturday, 18 March 2006 23:39 (twenty years ago)
― xhuxk, Saturday, 18 March 2006 23:42 (twenty years ago)
http://www.progpowerusa.com/
I'm listening to the debut Savage Circus album right now.
― scott seward (scott seward), Sunday, 19 March 2006 00:07 (twenty years ago)
xpost I thought scott said Savage Garden then for a minute.
― Brigadier Lethbridge-Pfunkboy (Kerr), Sunday, 19 March 2006 00:10 (twenty years ago)
Ha ha, Scott, isn't there some huge annual prog fest in Bethlehem, PA, though? That's closer!
No idea if Kill and Die Cheerleader are related (and my guess would be that Henry's recommendations are not to be trusted, though who knows?)
― xhuxk, Sunday, 19 March 2006 00:13 (twenty years ago)
http://www.nearfest.com/
But what are they gonna do when the abandoned steel factory is replaced with luxury condominiums, and all the Bethlehemers wind up commuting to New York (or whatever was claimed in that weird NY Times piece that I mailed to George a couple months ago.)
― xhuxk, Sunday, 19 March 2006 00:18 (twenty years ago)
― scott seward (scott seward), Sunday, 19 March 2006 00:50 (twenty years ago)
=1, right?
― Thomas Tallis (Tommy), Sunday, 19 March 2006 00:53 (twenty years ago)
"Free" on Huck's album is actually pretty rocking despite its STP-ness. (Maybe it's just his *voice* that sounds sort of grunge, more than his music; I haven't really decided yet. Just like Kill Cheerleader might be Swedish garage singing fronting L.A. glam-trash playing.)
― xhuxk, Sunday, 19 March 2006 01:06 (twenty years ago)
― pdf (Phil Freeman), Sunday, 19 March 2006 02:05 (twenty years ago)
― xhuxk, Sunday, 19 March 2006 02:08 (twenty years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Sunday, 19 March 2006 02:17 (twenty years ago)
I would too, but only if Slayer was holding swords in each hand at 90 degree angles
I dream of a world in which you don't hate on Slayer every chance you get
― Thomas Tallis (Tommy), Sunday, 19 March 2006 02:31 (twenty years ago)
(F.I.Y. - The new Phobia album on Willowtip could have sounded exactly like any other straight-up crusty grindcore album, BUT the Scott Hull production gives it a seriously crunchy sound. Like rock candy. Mmmmmm...candy.I think I have to go listen again.)
― scott seward (scott seward), Sunday, 19 March 2006 03:23 (twenty years ago)
Because the Hank Davison biker band is kicking my ass. Hard Way is DIY boogie and AC/DC rock, high on catchiness and good thumping shuffles. Cover a Foghat tune, "Trouble, Trouble" so far. Titles are prosaic but Hank sings good, he sounds like Bon sometimes or maybe most of the time, and they are from Germany or Czech Republic. And you can't tell, they sure sound American, except in one spoken word part where Hank's consonants start sounding Teutonic.
― George 'the Animal' Steele, Sunday, 19 March 2006 21:04 (twenty years ago)
― xhuxk, Monday, 20 March 2006 01:28 (twenty years ago)
"Amazing Ride" bout going for a bike rally, 'mading ride/side by side'. "Prisoner Blues" is a ZZ boogie with "How-how-how", very Texan for being from the Schwarzwald or Upper Silesia or Saxony or wherever they hail from. Lots of harmony guitar playing, shuffles and fast thumping rhythm for toe-tapping. Every song is catchy.
Better than most old Krokus which occasionally comes to upon listening, too.
― George 'the Animal' Steele, Monday, 20 March 2006 18:50 (twenty years ago)
― xhuxk, Monday, 20 March 2006 19:06 (twenty years ago)
― xhuxk, Monday, 20 March 2006 19:17 (twenty years ago)
I like the guitars. And the bass. And the drumming. Especially that one endless ending that just crashes and crashes forever and ever. I like the sound they get. I like what they do with doom metal. I like when they speed up and punk out. I like the chanting. I like the guitar solos. I'm pretty easy to please though. My fave album of the week is the new one by *Tyr*, *Eric The Red*. Total mid-tempo Greek Orthodox Church Men's Choir/Clancy Brothers marching hoe-down long-boat metal. Almost every song would sound just as good a capella. The guitars are almost an afterthought.
Chuck, did you get that album by *Naio Ssaion*? Finnish goth/fiddle metal with pop hooks. You might like that one. Unless you really hate fiddle metal.
― scott seward (scott seward), Monday, 20 March 2006 19:28 (twenty years ago)
The Complete Idiot's Guide to War
The Kevlar Brain Bucket
Comparisons to the Wehrmacht were intentional and now more apropos than three years ago, which I thought might not be possible at the time.
The Saddamizers was a good one, too, and ought to be the name of a heavy metal or ugly hard rock band.
― George 'the Animal' Steele, Monday, 20 March 2006 20:16 (twenty years ago)
Because it still hasn't been released in the US? I love it, though, except for "Te Quiero Puta," which just sounds like they're making fun of their huge South American fanbase.
― pdf (Phil Freeman), Monday, 20 March 2006 20:49 (twenty years ago)
The rest of Karmacode's pretty darn solid.
― a. begrand (a begrand), Monday, 20 March 2006 21:40 (twenty years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Monday, 20 March 2006 22:50 (twenty years ago)
as for military history, i'm something of a john keegan man myself. his work on the battle of the somme, against a backdrop of ernst junger's early essays on the genesis and origins of modern fascism can't be beat for this stuff! (all this i learned at...the graduate faculty at the new school, if you can believe it!)
major xpost.
― blackmail (blackmail.is.my.life), Monday, 20 March 2006 23:05 (twenty years ago)
I really LOVE fiddle metal, Scott! But I did not get that Nidal Sassoon album or whatever you said they were called. Maybe if I did they would belong on the same shelf as Fintroll and Skyclad! Those Greek Orthodox men's choir hoedown dudes sound interesting, too.
And I did not know Rammstein had not come out in the US yet. Oddly, I believe I reviewed *Sennsucht* or however you spell it as an import for Rolling Stone once upon a time, and months later the band sent me the only gold record plaque I have ever owned to thank me.
I did get Savage Circus in the mail today, though. Maybe I'll try that one tomorrow.
― xhuxk, Tuesday, 21 March 2006 01:02 (twenty years ago)
Ha ha, I totally disagree. Continental Europeans pretending to be Latin Americans (the Off, Magazine 60, Two Man Sound, Los Umbrellos, I think all those guys fit in there, and where were the Gibson Brothers from?) is one of my all-time favorite musical genres. And I'm not sure, but I think it's quite possible this is the funkiest song that Rammstein has ever done.
― xhuxk, Tuesday, 21 March 2006 01:15 (twenty years ago)
― xhuxk, Tuesday, 21 March 2006 01:38 (twenty years ago)
― xhuxk, Tuesday, 21 March 2006 02:05 (twenty years ago)
Yeah, I dig John Keegan, at least what I've bought of him. I have his The First World War and Six Armies in Normandy. I like the former best, but they're both very good books.
Since the new national security doctrine reserves the right for the US to strike preemptively with conventional or nuclear weapons, this still applies, too.
The Burrowing Nuke
I enjoy Night After Night on the Invaders comp best. It's well-played conventional power metal with a singer that doesn't suck. The Parchman Farm cut keeps me coming back, too.
― George 'the Animal' Steele, Tuesday, 21 March 2006 02:36 (twenty years ago)
― ng-unit, Tuesday, 21 March 2006 03:33 (twenty years ago)
― Yikes, Tuesday, 21 March 2006 03:55 (twenty years ago)
― George 'the Animal' Steele, Tuesday, 21 March 2006 16:29 (twenty years ago)
― scott seward (scott seward), Tuesday, 21 March 2006 16:33 (twenty years ago)
― scott seward (scott seward), Tuesday, 21 March 2006 17:17 (twenty years ago)
shit, you should hear her voice on the album before that one (finished with the dogs). tom angelripper would wince.
― baby, disco is fuck (yournullfame), Tuesday, 21 March 2006 19:16 (twenty years ago)
I guess it's the actualization of if you tell someone to take a shit electronically, they will videographically, even asking how much and what color?
― George 'the Animal' Steele, Tuesday, 21 March 2006 22:05 (twenty years ago)
Speaking of Kid Rock, people (me) tend to forget how great Devil Without a Cause is. Was thinking about him because I recently borrowed Rage Against the Machine's Los Angeles from the library and basically felt sad listening to it, how these guys seemed to have the moves, the noise, the dance, the energy, but ended up dry-as-dull-dust, the splash of music not even there as a mist or a droplet - though the album went platinum, so someone heard something. And it clobbered Kid Rock in Pazz & Jop, though the Kid went 9 times platinum so what does he care? Anyway, Rage seemed to just be short of someone like a Kid Rock to find them tunes and emotion and humor. But Kid has been a mystery to me since then, mainly because I stopped following after that boring second album, but the little I've heard after that left me puzzled. So, any more thoughts, especially his would-be country escapades, but not restricted to those? It seems to me that though Rage needed someone like him, he also needed something like Rage, some rhythm and noise to put his nonlegit voice in full effect.-- Frank Kogan (edcasua...), March 21st, 2006.
Ha, Frank, I can't even remember which "boring second album" by Kid Rock you mean! "Amercian Badass*? *Cocky*? There have been so many rip-off stop-gaps (most recently the live one, which I like just fine this week), I have trouble remembering which were the official ones. (Plus, *Devil Without a Cause* was something like his fourth; he actually had hinted at going the redneck route with *Early Morning Stoned Pimp* before that.) Anyway. All the ones since have had music I enjoy on them (more "music" than "songs"), and they're all pretty much been completely forgettable, and I assume I'll say the same thing about *'Live' Trucker* in two years, and I really don't mind for some reason. It's like the guy has taken a clue from his coked-out '70s country and rock heroes and settled on just being a dependable journeyman; I seriously doubt he has any interest in making an album as great as *Devil Without a Cause* again. And I disagree about him needing his own Rage Against the Machine. The Rage-style stuff on *Devil* (including, uh, the song with "rage" in the title) was the album's worst stuff, and the Twisted Brown Trucker Band have "the moves, the noise, the dance, the energy" at LEAST as much as Rage ever did to my ears, plus they've got a sense of fun and sense of humor and, hell, sense of funk that I never heard in Rage, so they *don't* end up dry as dust. (Though it's very possible I just never listened to Rage enough, or their vocalist got in the way of me hearing their music, like what happens to me with hip-hop so often.) I mean, Twisted Brown Trucker are more a hard rock boogie band than a complex Zep-style metal band I guess (I *assume* that's what people hear Rage as; am I wrong?), but that doesn't bug me. The first song on the live CD, "Son of Detroit," boogies quite funkerociously to my ears, and it's fun how they end with the Gap Band's "Outstanding". Oddly, the song that holds up worst for me on this CD (compared to its studio version) is "Only God Knows Why," which I think was my single of the year in Pazz and Jop the year it came out -- then again, maybe it's just that there's been such a huge and unexpected deluge of great Southern rock since then that it doesn't sound so special anymore, who knows. And I still kind of like "Picture," whether Sheryl or Alison or Gretchen are duetting on it, and I know you don't, Frank (not sure why, though.)-- xhuxk (xhux...), March 21st, 2006.
(I mean, I've talked about this on other threads plenty, gotten in arguments with Miccio about it and stuff. And I totally understand why people feel let down by the guy; he *did* pretty much turn into a hack, lost his sense of punchlines as much as the Beasties ever did, and so on. But I feel like his band has kept his head above water somehow, and some day I'll handpick a great CD-R out of his post-*Devil albums, and 10 years from now maybe some smart whippersnapper will argue convincingly that *Devil* wasn't even his best after all. Anyway, here's what I wrote about his last one, for whatever it's worth:http://www.villagevoice.com/music/0350,eddy,49290,22.html
-- xhuxk (xhux...), March 21st, 2006.
― xhuxk, Wednesday, 22 March 2006 00:19 (twenty years ago)
1) There are definitely good arguments available for moving from Limp Bizkit type music to Lynyrd Skynyrd type music (or even from Rage Against the Machine type music to Bad Company type music). (For example, here's one: melodies are *good* things.)
2) He makes better albums now than Eminem does (which I wouldn't have predicted.)
― xhuxk, Wednesday, 22 March 2006 01:14 (twenty years ago)
And by the way, speaking of *Cocky* (and Iraqis) the last line of this great RJ Smith review from late 2001 now seems eerily prescient; I wonder if Kid read it and took it to heart?
http://www.villagevoice.com/music/0151,smith,30841,22.html
― xhuxk, Wednesday, 22 March 2006 01:37 (twenty years ago)
― xhuxk, Wednesday, 22 March 2006 02:00 (twenty years ago)
http://cdbaby.com/cd/atomicbitch2
Also, nobody sent me that *Invaders* compilation. Hmm, I wonder why.
― xhuxk, Wednesday, 22 March 2006 02:33 (twenty years ago)
Again, coincidentally, having same blood with Sirens and Nagg only no girls allowed in this band, true blue biker dudes. Do they ride Holly Sportsters or BMWs?
― George 'the Animal' Steele, Wednesday, 22 March 2006 09:15 (twenty years ago)
― xhuxk, Wednesday, 22 March 2006 11:01 (twenty years ago)
And Hank Davidson biker band sound like they'd be right my alley, George, so thanks!
― xhuxk, Wednesday, 22 March 2006 11:03 (twenty years ago)
― xhuxk, Wednesday, 22 March 2006 14:32 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 22 March 2006 15:18 (twenty years ago)
― xhuxk, Wednesday, 22 March 2006 15:49 (twenty years ago)
...assuming they are not Ursalla, I mean. (CD cover & cdbaby don't say.)
― xhuxk, Wednesday, 22 March 2006 15:51 (twenty years ago)
― xhuxk, Wednesday, 22 March 2006 15:56 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 22 March 2006 17:02 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 22 March 2006 17:11 (twenty years ago)
am presently listening to the new Facedowninshit, which when I first got the promo in the mail made me think "haha I bet Chuck'll totally love a band called Facedowninshit"
― Thomas Tallis (Tommy), Wednesday, 22 March 2006 17:17 (twenty years ago)
That Propagandhi album from last year is really good. Best punk disc I heard last year.
― a. begrand (a begrand), Wednesday, 22 March 2006 18:37 (twenty years ago)
― George 'the Animal' Steele, Wednesday, 22 March 2006 21:00 (twenty years ago)
i'm gonna review the new celtic frost, so that gave me a good excuse to go get those spiffy vinyl reissues at the record store. morbid tales picture disc! i couldn't resist. i haven't heard into the pandemonium in years cuz i sold my copy at my ill-fated record store in philly years ago, so i got that too and
― scott seward (scott seward), Wednesday, 22 March 2006 21:18 (twenty years ago)
― scott seward (scott seward), Wednesday, 22 March 2006 21:20 (twenty years ago)
― pdf (Phil Freeman), Wednesday, 22 March 2006 22:06 (twenty years ago)
Really looking forward to hearing the new Celtic Frost. It took me forever to appreciate that band...back in 85/86, I thought they were garbage, and then Cold Lake came out, and I was convinced they were garbage. I remember seeing "Circle of the Tyrants" on tv back when To Mega Therion came out, and was all, "What is this shit?" It didn't start to hit me just how good those first three albums are until about five years ago. Now I think that video's pretty much the coolest metal video ever.
Oh, and there's a new Voivod track streaming at mp3.com. Bodes very well for the rest of the album...
― a. begrand (a begrand), Wednesday, 22 March 2006 22:37 (twenty years ago)
― Thomas Tallis (Tommy), Wednesday, 22 March 2006 23:06 (twenty years ago)
scott, do you have the new frost right now? i'm dying to hear it. or hear about it.
― baby, disco is fuck (yournullfame), Thursday, 23 March 2006 09:38 (nineteen years ago)
I've been listening to the Flyleaf album this morning. There IS some Bjork in Lacey's voice (in her sort of hiccups, which she seems to do a lot), I think; maybe some Tori Amos too, though I rarely remember what Tori sounds like when I'm not hearing her and I could be wrong about that. (Fiona Apple? I have no fucking idea.) And her growls sound a lot like Kittie. The "nu"-metal band that keeps springing to mind, though I'm not sure I can explain why though it's kind of obvious, is P.O.D., who are Christians, and who have enough of a sense of rhythm that I put their "Youth of the Nation" on my top 10 singles list a few years ago. (Sasha Frere-Jones has compared their drumming to Killing Joke's, I believe.) That "Cassie" song is intense; I like the rest, just not sure how much yet..(actually, not sure how much I like the intense one, either.)-- xhuxk (xedd...), March 23rd, 2006.
Interesting how in "Cassie" (did I hear this right?) Lacey winds up saying CASSIE pulled the trigger (by telling the Columbine shooters she believed in God I guess). And then, later in the song, I think LACEY pulls the trigger. Only listened once so far, though; maybe I misheard.-- xhuxk (xedd...), March 23rd, 2006.
― xhuxk, Thursday, 23 March 2006 16:48 (nineteen years ago)
Also got the Rodrigo y Gabriela CD (two Mexican guitarists who play versions of "Orion" and "Stairway To Heaven" alongside their own compositions). Killin' stuff, plus it includes a DVD with live footage...and a guitar tutorial! Learn to play the Rodrigo y Gabriela way!
― pdf (Phil Freeman), Thursday, 23 March 2006 17:49 (nineteen years ago)
(By the way, not sure whether it's clear from my Flyleaf post, but I've never had any use for Bjork, Tori, OR Fiona at all -- I was just trying to speculate for Frank, who is writing about the band, what Flyleaf's singer's vocal inspirations might be. As for Kittie, I've always kind of wanted to like them and they've never clicked; they're better when stop growling and go into Gathering/Lacuna goth mode, which they don't do nearly enough. The *Paperdoll* EP was kinda cute.)
― xhuxk, Thursday, 23 March 2006 18:09 (nineteen years ago)
Kill Cheerleader's still playable, too. They have a sloppy looseness, at least in the first and best few songs, that reminds me a lot of the Heartbreakers (Thunders's not Petty's), but there is a tuneful prettiness to the guitar parts that's often totally Van Halen via LA hair-metal; they earn the right to call one of their songs (not a cover) "Want Action" almost like Poison did. Out of a dozen tracks, only two power ballads -- "Go Away" and "No Lullabies" -- both better than tolerable, falling somewhere between 1991 GnR ballads and 1991 Nirvana ballads, which fortunately isn't as gross at its sounds.
― xhuxk, Thursday, 23 March 2006 18:23 (nineteen years ago)
"Brad Davis and I collaborate on all the music ( He performs every instrument on the record)... He is in touch with his "inner tramp" and we coaxed our friends Aqualine and LAdy Dre( SOuthern SKanks like us to guest Rap on the Record) We had a great time laughing and drinking Tequila on Lipstick.. KAylan Romero also did some guest backup vocals/guitars on Short BUS."
― xhuxk, Thursday, 23 March 2006 18:36 (nineteen years ago)
March 2004:
http://www.arthurmag.com/images/covers/a9.jpg
― JayBabcock (jabbercocky), Thursday, 23 March 2006 19:10 (nineteen years ago)
July 31, 2002 cover feature in LAWeekly:
http://www.laweekly.com/features/3701/empire-of-doom/
― JayBabcock (jabbercocky), Thursday, 23 March 2006 19:13 (nineteen years ago)
Send me the pr contact so I can ask for one.
Scott, do you have or have you heard Ruby Starr's old Stone Junkie LP? If so, what's it like?
Old K-Tel fans tip of the day: Studio 99's tribute to Zep, again a pickup band of Brit studio hacks doing the old reliables. I was surprised how much I liked it, to the point that I didn't have to get up and immediately put on the originals.
― George 'the Animal' Steele, Thursday, 23 March 2006 19:56 (nineteen years ago)
― pdf (Phil Freeman), Thursday, 23 March 2006 20:03 (nineteen years ago)
― Ned Raggett (Ned), Friday, 24 March 2006 03:39 (nineteen years ago)
Kathy X, *Ready for Anything*: minimalist clippity-clop semi-hopped-up rockabilly rhythm from two not-so-young guys who keep their mouths shut provides frame for a not-so-young woman to both rant in endearingly tuneful semi-hiccuped british accent and steal noisy link wray twangs in short songs about cat fights and demon possession, plus one joan jett cover. energetic, in a way closer to girlschool than the stray cats. i like "love they neighbor," "i love rock'n'roll," "ready for anything," "let the devil in," "bitch like you," "black box" (for starters.)
― xhuxk, Friday, 24 March 2006 16:00 (nineteen years ago)
― xhuxk, Friday, 24 March 2006 16:24 (nineteen years ago)
okay, i got a copy today (all very hush hush(???)anyway, i'm just glad to have a copy so that my review will get in the next issue. if i had to wait for record people to send me one,i would be buying my copy at walmart before it ever got to me. and they got the right person to review it, cuz the only thing i know how to burn is toast if they are worried about dirty bootleggers). all i can say after one listen is: it's scary good. like, the best thing they ever did good. super-heavy, super-doomy. it sounds like a dream. i almost had to pinch myself. do i just WANT it to sound great cuz i'm a fan and i'm overrating it? nope, i don't think so. it's that good. i will add more later. i still have to write about it.
blabbermouth has a good account of a euro-listening party and i agree with everything that guy has to say about the album:
http://www.roadrunnerrecords.com/blabbermouth.net/news.aspx?mode=Article&newsitemID=49387
― scott seward (scott seward), Saturday, 25 March 2006 20:23 (nineteen years ago)
September 19, 2006 Pittsburgh, Pennsylvania Rex Theatre September 20, 2006 Cleveland, Ohio House of Blues September 22, 2006 Detroit, Michigan HarposSeptember 23, 2006 Chicago, Illinois Vic Theatre September 24, 2006 Minneapolis, Minnesota First Avenue September 25, 2006 Winnipeg, Manitoba Royal Albert Arms September 27, 2006 Calgary, Alberta The Warehouse September 28, 2006 Edmonton, Alberta The Starlite Room September 30, 2006 Victoria, British Columbia SugarOctober 1, 2006 Seattle, Washington El Corazón October 2, 2006 Portland, Oregon RoselandOctober 3, 2006 San Francisco, California Fillmore October 4, 2006 San Diego, California House of Blues October 6, 2006 Anaheim, California House of Blues October 7, 2006 Los Angeles, California House of Blues October 8, 2006 Phoenix, Arizona Marquee Theater October 9, 2006 Las Vegas, Nevada House of BluesOctober 11, 2006 Englewood, Colorado Gothic TheaterOctober 12, 2006 Albuquerque, New Mexico Sunshine Theatre October 13, 2006 El Paso, Texas The ZoneOctober 14, 2006 San Antonio, Texas Sunset Station - Lonestar October 16, 2006 Lawrence, Kansas Bottleneck October 17, 2006 Saint Louis, Missouri Pop's October 19, 2006 Fort Worth, Texas Ridglea TheaterOctober 20, 2006 Houston, Texas Warehouse Live October 21, 2006 New Orleans, Louisiana House of BluesOctober 23, 2006 Saint Petersburg, Florida State Theater October 24, 2006 Fort Lauderdale, Florida Culture Room October 25, 2006 Orlando, Florida House of Blues October 27, 2006 Atlanta, Georgia The Masquerade October 28, 2006 Myrtle Beach, South Carolina House of Blues October 29, 2006 Fayetteville, North Carolina Jester's Pub October 31, 2006 Charlotte, North Carolina TremontNovember 2, 2006 Norfolk, Virginia The NorvaNovember 3, 2006 Poughkeepsie, New York Chance TheatreNovember 4, 2006 Worcester, Massachusetts Palladium
― scott seward (scott seward), Saturday, 25 March 2006 20:27 (nineteen years ago)
"It's my goal to make the next record even heavier and gloomier," he points out.
"If that's possible..." is my reply.
"Yes it is," he says assuredly.
What about live shows? What tracks are we going to hear?
"Of course, some new tracks and then older ones from 'Morbid Tales', 'To Mega Therion' and 'Into The Pandemonium'," Tom reveals. "We don't play anything from 'Cold Lake' or 'Vanity/Nemesis' as they are not 'real' CELTIC FROST albums. And maybe it's time to play 'Triumph Of Death' by HELLHAMMER. We will see."
― scott seward (scott seward), Saturday, 25 March 2006 20:28 (nineteen years ago)
― scott seward (scott seward), Saturday, 25 March 2006 20:30 (nineteen years ago)
I never had a problem with Kid because he stayed true to the rap-metal of my youth, that is the formative years of the genre-meld, that is when it was best (or at least when I was still paying attention). His best work was him acting like the Areosmith-Run-DMC collab took place last week. I also didn't mind the redneck infusion for that matter because we all know Skynyrd had soul.
Speaking of which, that was always my problem with Rage Against The Machine. That band had a pretty good idea and gobs of integrity but absolutely zero soul. That's why they bored me real quick. That and Zach's constant preaching. A marked contrast to both is Audioslave which shows that the boys did have a little soul in 'em after all, they just had to get away from saving the world to find it. Which makes sense, really.
By the way, I really, really like the new Sepultura disc. Nobody's buying it in my store, however. Once you jump the shark, it's hard to convine people that you can still deliver.
Oh, and as for the Hellhammer/Celtic Frost commentary - anyone hear Incriminated? The band has that vibe down to a tee. The vocals are so ridiculously heavy/stupid that I laughed at it. The first disc I got from them had what sounded like him gargling at times. But it was still heavy and raw and fun.
― Brian O'Neill (NYCNative), Saturday, 25 March 2006 21:00 (nineteen years ago)
GitoGito Hustler, all girl pop punk and hard trash rock on Gearhead. New album Love & Roll has a David Seville & the Chipmunks with electric guitars-sounding version of "Locomotion." And I'm not stretching it in the slightest. Four small very nice girls, I met 'em and they don't speak English but know how to say 'Hello' and look pleased to see you. Their Japan only releases were also proferred and Ready Go, an EP was good -- particularly "Tokyo Boogie Woogie," better after one listen than the scheduled domestic release. Time will tell how both grow or stick with me but the drummer, Fusa, occasionally reaches out of the mix and grabs you buy the lapels with her grasp of rockabilly, monkey and Bo Diddley beat. It doesn't happen all the time, maybe it should, but there's no denying it makes the songs better when it happens. They gave me one 10-inch vinyl thing printed almost entirely in Japanese so it could be Pontius Pilate and the Nail-Drivin' Five because I haven't played it yet to see if it's actually them but it probably is.
And The Spunks, also from NYC by way of Tokyo, gearing up for a Gearhead CD -- and you know all these bands are shouldering the studio costs themselves so the indie handles only distribution and manufacturing. But they have a domestic/Japanese something in English called Born to Be Mild and I could only listen to two thirds of it before bedtime but they really love rock 'n' roll, like a lot of Japanese bands ala Guitar Wolf say they do, but often can't really play very good at all. Spunks can play it good for a change. Plus they have a sense of humor of themselves with a tune I didn't get to listen to, "I Love Wok & Roll." And their drummer, an all around good guy, is Al Batross, who started Ludichrist and eventually played in MDC for a bit.
― George 'the Animal' Steele, Saturday, 25 March 2006 21:30 (nineteen years ago)
And this release on Gearhead is almost completely different than their Ready Go EP released in Japanese-land. Ready Go is better because of sonic choices, or production, or something, and it sounds more rational. The guitars whoosh and chug and it's smooth rather than crashing. Somewhat fewer caffeine pills in them and they resemble Go Betty Go on their first EP. Ready Go would have been my choice to release first but, hey, they're being pitched to the Lords of Altamont and such fans so maybe noisy and garagey is the way to go. Plus they sing in Jap-lish so you have no idea what any of the songs are about most of the time.
― George 'the Animal' Steele, Sunday, 26 March 2006 17:14 (nineteen years ago)
anybody who likes Norweigan blackdeath stuff, the new Aeternus is ALL that & two bags of chips besides - totally great
― Thomas Tallis (Tommy), Sunday, 26 March 2006 17:40 (nineteen years ago)
― baby, disco is fuck (yournullfame), Sunday, 26 March 2006 17:47 (nineteen years ago)
― xhuxk, Sunday, 26 March 2006 19:33 (nineteen years ago)
http://cdbaby.com/cd/zeros
and here's another cdbaby pop-metalish CD lacking the tuneage i was hoping for; oh well:
http://cdbaby.com/cd/jackierock
― xhuxk, Sunday, 26 March 2006 20:36 (nineteen years ago)
― Ned Raggett (Ned), Sunday, 26 March 2006 20:40 (nineteen years ago)
― scott seward (scott seward), Sunday, 26 March 2006 20:45 (nineteen years ago)
― scott seward (scott seward), Sunday, 26 March 2006 20:46 (nineteen years ago)
I did. Liked it but it wasn't a keeper. Every five years I just toss stuff in boxes and put it in the recycle bin to clear out the clutter and that was a hasty casualty. Good clear-eyed account of being in a cult metal band and how it does/did/or doesn't often pay the bills.
― George 'the Animal' Steele, Sunday, 26 March 2006 22:40 (nineteen years ago)
― xhuxk, Sunday, 26 March 2006 22:47 (nineteen years ago)
― Thomas Tallis (Tommy), Sunday, 26 March 2006 23:38 (nineteen years ago)
― George 'the Animal' Steele, Sunday, 26 March 2006 23:43 (nineteen years ago)
by the way, am i the only *cold lake* and *vanity/nemesis* fan here? i even liked those guys when they sold out! and i actually think their earliest stuff is their *worst* stuff.
― xhuxk, Sunday, 26 March 2006 23:48 (nineteen years ago)
― xhuxk, Sunday, 26 March 2006 23:57 (nineteen years ago)
― scott seward (scott seward), Monday, 27 March 2006 00:00 (nineteen years ago)
― xhuxk, Monday, 27 March 2006 00:03 (nineteen years ago)
― Ned Raggett (Ned), Monday, 27 March 2006 00:19 (nineteen years ago)
― scott seward (scott seward), Monday, 27 March 2006 00:46 (nineteen years ago)
and by the way though, just to demonstrate i'm not alone in this, here are ratings from martin popoff (who is actually more extreme on the improving-over-time issue than i am; i.e., i'd definitely rank "into the pandemonium* higher than the two LPs that followed it):
morbid tales - 5emperor's return EP - 6to mega therion - 7tragic serenades EP - 6into the pandemonim - 7cold lake -8vanity/nemesis - 91984-1992: parched with thirst am i and dying - 8
― xhuxk, Monday, 27 March 2006 01:02 (nineteen years ago)
― xhuxk, Monday, 27 March 2006 01:17 (nineteen years ago)
If I just want straight up continental thrash, I'll listen to Kreator or later thrashy death like Pestilence. With CF, I'm mainly interested in their "avant garde" and pop pretentions. Which makes sense, since bands like Korova(kill) and Angizia are more interesting me these days than straight up German/Austrian black/death metal.
― James Slone (Freon Trotsky), Monday, 27 March 2006 04:17 (nineteen years ago)
― James Slone (Freon Trotsky), Monday, 27 March 2006 04:18 (nineteen years ago)
― James Slone (Freon Trotsky), Monday, 27 March 2006 04:23 (nineteen years ago)
― a. begrand (a begrand), Monday, 27 March 2006 08:12 (nineteen years ago)
― James Slone (Freon Trotsky), Monday, 27 March 2006 10:45 (nineteen years ago)
― scott seward (scott seward), Monday, 27 March 2006 21:55 (nineteen years ago)
― pdf (Phil Freeman), Monday, 27 March 2006 23:44 (nineteen years ago)
right, sure sure, but Warrior has Lou Reed revisionism syndrome: he wants to argue that they were just throwing anything they could think of into the mix and creating great records more or less at random AND that they were fiercely clinging to a very specific vision in the face of, etc., etc. Conscientious visionary originals admit that they were just sorta following the vision and didn't really have the whole thing under control.
I dunno, I just found the book irritating. I don't hate Cold Lake as much as everybody else usually does - "Cherry Orchards" is a decent jam - but better than Tragic Serenades, good Christ no, it's not even in the same league
― Thomas Tallis (Tommy), Tuesday, 28 March 2006 01:18 (nineteen years ago)
― George 'the Animal' Steele, Tuesday, 28 March 2006 03:23 (nineteen years ago)
BLOODY ROOTS Week of April 17, 2005
THE BLOODY ROOTS OF SWISS METAL____________________
[CDR TRACK 1] CELTIC FROST - "Inner Sanctum" from INTO THE PANDEMONIUM
[CDR TRACK 2] YOUNG GODS - "Envoyé" from ENVOYÉ 12"
[CDR TRACK 3] HELLHAMMER - "The Third of the Storms (Evoked Damnation)" from APOCALYPTIC RAIDS
[CDR TRACK 4] KROKUS - "Long Stick Goes Boom" from ONE VICE AT A TIME
[CDR TRACK 5] CORONER - "Read My Scars" from NO MORE COLOR
[CDR TRACK 6] EMBALMING THEATRE - "Hallucinating Genitals-Ejector" from split CD w/FRIGHTMARE
[CDR TRACK 7] FRACTAL POINT - "Parallel Worlds" from THE BIZARRE MACHINERY OF UNIVERSE
[CDR TRACK 8] DARK DAY DUNGEON - "Passion" from KNOW YOUR ENEMY
[CDR TRACK 9] PIGSKIN - "Run Down" from EPIDEMIC
[CDR TRACK 10] CATARACT - "Save Their Aim" from GREAT DAYS OF VENGEANCE
[CDR TRACK 11] SAMAEL - "Moongate" from REIGN OF LIGHT
[CDR TRACK 12] ALASTIS - "Eternal Cycle" from REVENGE
[CDR TRACK 13] FOREST OF FOG - "Die Zeit des Sturmes" from DEMO
[CDR TRACK 14] CELTIC FROST - "Ground" from 2004 REHEARSAL
― Ian Christe (Ian Christe), Tuesday, 28 March 2006 16:40 (nineteen years ago)
so, stop the presses, this album from australia is what avril and kelly (and uh, maybe even ashlee and skye and hope) *should* sound like. which is to say, like the first-album divinyls except less arty and more consistently catchy and funny and sexy, often (in "you stink" and the great and hilarious and furious cheated-on-revenge single "holding your gun" for instance) doing a fast mott the hoople (or angel city?) boogie-woogie hard rock under thick guitar buzz. the *gun* EP threw me at first because it opens with leanne kingwell (that's her name, remember it) doing two power ballads (one of them apparently a cover, since it's credited to john watts and the lyrics aren't in the lyric booklet of the album) with prim and proper aussie pronunciation like for instance pronouncing "france" "frontz", but in the course of the album (now called *show ya what,* which seems to be mostly a reissue of the 2005 album that's up on cdbaby, with "holding your gun" replacing "back to me" and the track order shuffled) the ballads make way more sense, partially by being less plentiful...and okay, i also just noticed that the track "be with you" is credited to brewster/brewster/neeson, which means i was RIGHT about the angel city comparison. "blind" is credited to one james stewart; the rest are kingwell herself. "drop your pants" starts out like "hey little girl" by the syndicate of sound (which the divinyls covered), then gets tougher and thicker, like the sonics, but the effect isn't '60s garage rock nostalgia at all, probably because leann's vocals (basically, she sings a lot like christina amphlett at her most rocking) are the most powerful element in the mix. and also maybe as a tribute to christina, in "my hero" she touches herself. with her vibrator. which is better than you. predicton (probably premature, but who cares, what else is new with me): *show ya what* could wind up being one of the best albums of 2006; "holding your gun" might be one of the best singles.
http://cdbaby.com/cd/kingwell
http://cdbaby.com/cd/kingwell2
― xhuxk, Tuesday, 28 March 2006 19:10 (nineteen years ago)
>"I saw The Angels gig at the Palace in 2000 and it absolutely knocked me out. I was one of a dozen girls in a room of about 1500 guys who just went off and knew the words to every song. That gig got me thinking about how to create some kick arse rock n' roll that girls would dig as much as guys."<
>A four track EP featuring a cover of Fischer Z's 1980 smash "So Long" plus 2 originals.<
and yeah (as reviews on those pages say) i definitely hear the easybeats and suzi quatro in there, too.
― xhuxkx, Tuesday, 28 March 2006 19:17 (nineteen years ago)
Got Abominable Iron Sloth lined up to play soon, just because I like their name. (They should've called their CD *To Megatherium*! In case nobody gets that cenozoic reference, here's a google image search):
http://images.google.com/images?q=megatherium&hl=en&btnG=Search+Images
I may well skip all the other random relapse grindcorologists and impaled nazarenes that came in the mail today, though, unless provided a real convincing reason why I shouldn't.
― xhuxk, Tuesday, 28 March 2006 20:38 (nineteen years ago)
New Danko Jones EP, I think on Razor & Tie. Is it going to help? Big in Canada, couldn't get arrested upon release of domestic first product last year. I no longer remember what they sound like.
― George 'the Animal' Steele, Tuesday, 28 March 2006 20:53 (nineteen years ago)
― pdf (Phil Freeman), Tuesday, 28 March 2006 20:57 (nineteen years ago)
― Thomas Tallis (Tommy), Tuesday, 28 March 2006 21:13 (nineteen years ago)
― xhuxkx, Tuesday, 28 March 2006 21:54 (nineteen years ago)
― James Slone (Freon Trotsky), Tuesday, 28 March 2006 23:55 (nineteen years ago)
― xhuxk, Wednesday, 29 March 2006 00:49 (nineteen years ago)
Actually, Danko Jones is far from big in Canada. He flirted with success about four or five years ago, when Hivesmania was kicking into gear, but interest waned, and his label dumped him. This EP is sort of a comeback for him (I haven't heard it), but it's not exactly setting the charts on fire up here.
― a. begrand (a begrand), Wednesday, 29 March 2006 02:17 (nineteen years ago)
― xhuxk, Wednesday, 29 March 2006 12:41 (nineteen years ago)
― rizzx (Rizz), Wednesday, 29 March 2006 19:30 (nineteen years ago)
I can't front: none!
― Thomas Tallis (Tommy), Wednesday, 29 March 2006 21:01 (nineteen years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Wednesday, 29 March 2006 21:05 (nineteen years ago)
Those goregrind reviews are gonna write themselves.
more on my metal life as it progresses.
― scott seward (scott seward), Wednesday, 29 March 2006 21:54 (nineteen years ago)
http://cdbaby.com/cd/savagerocksyou2
― xhuxk, Wednesday, 29 March 2006 22:29 (nineteen years ago)
Producer: Nic Atomik.
If people think they also belong on the psych/drone/freak thread, feel free to cut and paste, or let me know and I'll do so myself.
― xhuxk, Wednesday, 29 March 2006 22:32 (nineteen years ago)
― George 'the Animal' Steele, Wednesday, 29 March 2006 22:37 (nineteen years ago)
― xhuxk, Wednesday, 29 March 2006 22:41 (nineteen years ago)
― Ned Raggett (Ned), Wednesday, 29 March 2006 22:41 (nineteen years ago)
― George 'the Animal' Steele, Wednesday, 29 March 2006 22:43 (nineteen years ago)
Now don't freak Chrome fans. I was a fan 'fore you were and even put 'em on the cover of my fanzine in grad school. Definitely "Dirty Tricks" has the same fuzzy tone of Chrome-tune.
― George 'the Animal' Steele, Wednesday, 29 March 2006 22:48 (nineteen years ago)
― xhuxk, Wednesday, 29 March 2006 22:50 (nineteen years ago)
"You come to rape and pillage and take advantage of the land of the free."
That was lika a quote by some old white coot in the LA Times today about the school walkouts and immigrant protests blocking highway on ramps.
― George 'the Animal' Steele, Wednesday, 29 March 2006 22:53 (nineteen years ago)
― George 'the Animal' Steele, Wednesday, 29 March 2006 22:55 (nineteen years ago)
― scott seward (scott seward), Wednesday, 29 March 2006 23:09 (nineteen years ago)
these Pennsylvanians ("crosses No Doubt with Evanescence and little Disturbed...sometimes referred to as Dance Rock") sound promising to me, though the girl singing has a pretty rough voice (which could wind up waking in their favor more than against them):
http://cdbaby.com/cd/hollistunes
(Anyway, I'm still undecided about how much I like them. Their lyrics quote "Shake Your Booty" and "Into the Groove," I'm just not sure yet how clumsily. So far I prefer the synth parts to the funk basslines. And so far my favorite tracks are probably "Waiting" and "Better Day," two of their poppiest and least disco-metal and least rough-voiced.)
― xhuxk, Thursday, 30 March 2006 16:27 (nineteen years ago)
http://www.blacktable.com/dorfman040906.htm
― Brigadier Lethbridge-Pfunkboy (Kerr), Thursday, 30 March 2006 19:11 (nineteen years ago)
― George 'the Animal' Steele, Thursday, 30 March 2006 19:32 (nineteen years ago)
http://www.metalunderground.com/news/details.cfm?newsid=12898
― Brigadier Lethbridge-Pfunkboy (Kerr), Thursday, 30 March 2006 20:22 (nineteen years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Thursday, 30 March 2006 20:28 (nineteen years ago)
― George 'the Animal' Steele, Thursday, 30 March 2006 20:47 (nineteen years ago)
― xhuxk, Thursday, 30 March 2006 21:35 (nineteen years ago)
thursday, may 25, 2006
stinking lizaveta -- they're still around?kylesagraves at seaconiferrosettaultralordTBA
friday, may 26, 2006
orange goblin -- coming back to the USA for a handful of dates after five or six albums and total indifference. Bless 'em, I liked a couple of 'em although they all sound the same.scissorfightelectro quarterstafffacedowninshitTBArueTBA
saturday, may 27, 2006
colour hazedixie witchconfessorgrief -- almighty and doom to the unlistenable side Grief reunite. I'm the only Grief fan in the world, or I was the last time I posted to ILM on them. Used to be on the great Pessimiser label which specialized in total crap with great juvenile artwork. Now if only 16 would reuinite.brought lowred giant -- I liked one of their albums. It's here somewhere. Maybe I'll look for it.lamontlow dividered elitebaronessvillage of dead roads
sunday, may 28, 2006
borissunn0)))atomic bitchwaxweedeaterrwaketummlera thousand knives of fireminsktrephinehyatariasschapelunfortunautgreywe're all gonna die
― George 'the Animal' Steele, Thursday, 30 March 2006 23:38 (nineteen years ago)
― xhuxk, Friday, 31 March 2006 12:58 (nineteen years ago)
― xhuxk, Friday, 31 March 2006 13:17 (nineteen years ago)
As an aside: neither Cepacol nor Chloraseptic are good for singing voices - in fact, while affording pain relief, they're somewhat harmful to vocal cords. Only rest and adequate hydration are useful tonics for the voice; all other folk remedies (hot tea, water with lemon, throat sprays, etc etc) don't really help.
― Thomas Tallis (Tommy), Friday, 31 March 2006 13:20 (nineteen years ago)
i DID kinda like the one saviours EP (3 songs?) i heard last year (even mentioned it on the '05 rolling metal thread i believe), so you may be right. and i think i got sent that new album; thanks for reminding me!
― xhuxk, Friday, 31 March 2006 14:29 (nineteen years ago)
do people who defended propaghandi (who i still have no opinion on) upthread like against all authority, too? reason i ask is that, a few years ago, my teenage daughter went through a thankfully short-lived political punk phase, and liked both bands. anyway, i just listened to the new against all authority album, or half of it anyway, and they seem...um, not horrible. but not too good either. very wordy, vaguely rancid-ish vocals i didn't hate, a nonstop nonrocking quasi-polka hopscotch rhythm that got on my nerves. i'm sure they mean well.
american heartbreak CD on liquor and poker: cover makes you think they'd sound like black crowes, and they wear UFO and '70s aerosmith shirts, but they appear to be just a lousy pop-punk band who've learned a really obvious ac/dc riff or two. vocals are definitely that peter-brady-voice-changing pop-punk nasal thing. get it out of here.
― xhuxk, Friday, 31 March 2006 18:44 (nineteen years ago)
― Thomas Tallis (Tommy), Friday, 31 March 2006 18:48 (nineteen years ago)
Got an e-mail appeal today to sign a petition to put metal show back on Fuse. I used to watch Fuse and would catch it. Didn't like Fuse -- two years ago it seemed all emo/screamo and went boring fast. Had no opine on the metal show but it was hosted by a tough girl. The petitioner demands Fuse reinstate her. And the petitioner is a student from Kent State whose heart is in the right place although petitions almost never -- probably never -- work.
Shoulda spellchecked the petition in Word before sending it though since it's too be redirected to a suit in Fuse corporate. Ya don't want him to think metal fans are stupid or have no money to buy things the advertisers want advertised besides a few metal CDs.You could try to get Fuse dropped by cable providers nationally.That would hurt them. You could do it by requesting more Spanishlanguage programming, which would have a good chance of appealing tothe provider if they're not in the process of doing it already.In fact, I think my cable company may have dropped Fuse for foreignlanguage programming already which is why I haven't seen it in awhile.
― George 'the Animal' Steele, Friday, 31 March 2006 19:24 (nineteen years ago)
― ng-unit, Friday, 31 March 2006 20:04 (nineteen years ago)
― ng-unit, Friday, 31 March 2006 20:09 (nineteen years ago)
― xhuxk, Friday, 31 March 2006 20:12 (nineteen years ago)
― xhuxk, Friday, 31 March 2006 20:48 (nineteen years ago)
― George 'the Animal' Steele, Friday, 31 March 2006 20:59 (nineteen years ago)
― George 'the Animal' Steele, Saturday, 1 April 2006 18:39 (nineteen years ago)
nathan@napalmrecords.com
there is a phone-number on the site too: http://www.napalmrecords.com/
― scott seward (scott seward), Saturday, 1 April 2006 19:03 (nineteen years ago)
Really wanted to like Sonata Arctacus's *For the Sake of Revenge* in a Wolf-style way given that they're apparent vikings with a cool charging timberwolf on the cover of their CD, but no dice. Way too Maiden opera-metal, and not in as catchy or eccentric a way as I hoped.
Witchcraft track on *Invaders* is great. High on Fire and Sword tracks don't seem too bad.
Liking those Pennsy cdbaby new wave-synthed teen-rock disco-metallers Hollis more than I expected, especially ("Chemical," "Waiting," "Better Day," "Fade," "Automatic") when they can the gnu-metal shtick and let their girl Holly get her Patty Smythe and maybe Benatar on. "Fade" has '80s Bryan Adams riffs, and I can actually imagine people moving their thing to "Move That Thing," the song that quotes "Into the Groove". "Torn & Broken" and "Keep Me Down", where they try to act tougher, aren't quite so fun. But thumbs up regardless.
― xhuxk, Saturday, 1 April 2006 19:04 (nineteen years ago)
― scott seward (scott seward), Saturday, 1 April 2006 19:14 (nineteen years ago)
I find it hard to get beyond Sonata's keytar antics, but when I'm listening to them and not watching them, the hooks always win me over...when this band is on, they're pretty great. Kakko's an amazing singer, and the performances on the live album are tight. The DVD's a bit of a disappointment (not widescreen, the surround mix sucks), but I still give the whole thing a passing grade.
The Celtic Frost album has leaked, and Scott's right...this sucker is massive.
― a. begrand (a begrand), Saturday, 1 April 2006 19:21 (nineteen years ago)
oh good, i'm glad you agree. i kept thinking i was maybe wishing greatness upon it, but every time i listen it just sounds better and better. it's the first time at decibel that i've wanted to give an album a 10.
― scott seward (scott seward), Saturday, 1 April 2006 19:42 (nineteen years ago)
― scott seward (scott seward), Saturday, 1 April 2006 19:47 (nineteen years ago)
This album has me floored. Tom has a cool Peter Murphy thing going on with his vocals, and those female vox work brilliantly.
I'm supposed to be reviewing other albums today, but how can I with this thing begging repeat listens?
― a. begrand (a begrand), Saturday, 1 April 2006 20:49 (nineteen years ago)
― scott seward (scott seward), Saturday, 1 April 2006 21:14 (nineteen years ago)
Tunes I like best are "Rambin' Gamblin' Man," the Seger cut, "Oh Yeah," "Infatuation." He's also not half-bad with contemplative singer-wongwriter stuff. One of the better pieces of major label product I've heard in awhile. Probably like it a lot more in the final than The Darkness' second LP. Weirdly, I hear more LA than Detroit in it which fits the description because while the cover says he's heartland he's been living in Santa Monica for the past few years says the bio.
Tommy Conwell & The Little Kings "Hi Ho Silver" is also excellent. Conwell was a Philly man, grabbed up and managed by the Mountainfirm in the salad days of the Hooters/Robert Hazzard and theCabarets. Wound up with a deal from Columbia in 1988, was going to be the next big thing, RS did a big feature on him, the album came out and in the next two or three years grunge buried him.
Hi Ho Silver is frenetic rockabilly metal, lots of Dolls/Thunders influence. "Bip Bop Bop," done as stolen from Barrence Whitfield and the Stooges sounds like James Williamson stepped in on lead guitar. "Honey Hush" is done in the old Foghat way. "Born To Lose" is the old Heartbreakers tune and he in coversJoan Jett's "Make Believe."
Sounds nothing like his old major label style. Maybe he was always cool with the street rock stuff, just didn't get a chance to play it while mgmt was giving him material done by the Philly Hooters/Hazzard songwriting team. Or maybe he had a chance to start listening to it after Columbia set him down and the big stages were done with, getting into the Dolls and the Stooges. Actually, it sounds like the Dolls only if the Dolls had been less inept musically and poorly produced on their majors rather than what they were which was the opposite, well produced but with it wasted on what was being sent to tape. Or if first album Foghat did Johnny Thunders tunes produced by Dave Edmunds around the time of Love Sculpture or something like that.
― George 'the Animal' Steele, Sunday, 2 April 2006 15:49 (nineteen years ago)
― xhuxk, Sunday, 2 April 2006 15:57 (nineteen years ago)
On Hi-Ho-Silver it's all about kicking up the dust of rock 'n' roll with squealing guitar leads.
― George 'the Animal' Steele, Sunday, 2 April 2006 16:16 (nineteen years ago)
Come to think of it, some of this stuff -- not all of it -- The Queers and the Joan Jett tune would fit on Teenpop.
Caught Bon Jovi's vid in one of the top slots on VH1. The tune is OK but I'm not buying his born again country rocker/John Mellencamp in the heartland shtick. He was always really good at packaging. And, boy, it seems they've been flogging the Have a Nice Day album forever. Finally, it's working a bit but I'm wondering how much they're in the hole on the payola to get 'em on all the country shows, the TV commercial for the stereoTVcellphone, the videos ...
The LA Times might have mentioned a few weeks ago that the album might have edged the million seller mark but that still sounds like not enough to guarantee a profit.
― George 'the Animal' Steele, Sunday, 2 April 2006 17:27 (nineteen years ago)
― pdf (Phil Freeman), Sunday, 2 April 2006 17:53 (nineteen years ago)
http://www.mpprojects.com/tc/buzz.htm
― xhuxk, Monday, 3 April 2006 13:00 (nineteen years ago)
All these things get a new life in the ether of cyberspace. Does it matter, does anyone d/l them except one or two? Damned if I can tell.
― George 'the Animal' Steele, Monday, 3 April 2006 14:08 (nineteen years ago)
http://cdbaby.com/cd/st37
I'd post it on the dronepyschfreak thread too, but that thread just gets more boring by the minute, so my inclination is now to avoid it.
― xhuxk, Monday, 3 April 2006 14:20 (nineteen years ago)
The one time Creem sent me anywhere was to Columbia in NYC to interview Buck Dharma. And after it was over the promo person was all hepped up about Tommy Conwell & the Young Rumblers whose Rumble hadn't been released yet. She assured me it was great and that she'd send a copy in the following week. She did and it was a good but not great record. But it did was their moment in the sun. It almost seemed like they might take off like the Hooters had. I never saw them in Philly but he had a delirious following in the Valley, as a result, for a short period of time.
Oh yeah, I did see them at the Spectrum, opening for George Thorogood two years later. By that time the second record was out and he was wearing a raccoon tail and outfit ala Ted Nugent onstage and I remember thinking they'd gone downhill and in the wrong direction.
― George 'the Animal' Steele, Monday, 3 April 2006 14:22 (nineteen years ago)
That ST 37 cdbaby page has people comparing them to Scrach Acid, the Butthole Surfers, Amon Duul, Can, Chrome, the Wipers, and Hawkwind -- wishful thinking in most cases. But as pigfuckers go, they're at least somewhat melodic, which still counts for something in this day and age.
― xhuxk, Monday, 3 April 2006 14:38 (nineteen years ago)
― xhuxk, Monday, 3 April 2006 16:17 (nineteen years ago)
― xhuck, Monday, 3 April 2006 16:33 (nineteen years ago)
― George 'the Animal' Steele, Monday, 3 April 2006 17:05 (nineteen years ago)
Goes great with Tommy Conwell. I completely don't get Huck's image with big acoustic guitar leaping in front of a rusty warehouse with corrugate metal walls. Detroit -- rust -- wifebeater T -- baseball cap?!? It makes sense if you're trying to convey ruin and blight but Huck's music has more hope in it, not much blight at all.
― George 'the Animal' Steele, Tuesday, 4 April 2006 05:51 (nineteen years ago)
― George 'the Animal' Steele, Tuesday, 4 April 2006 05:55 (nineteen years ago)
― Colonel Poo (Colonel Poo), Tuesday, 4 April 2006 09:33 (nineteen years ago)
http://cdbaby.com/cd/bigdictator
― xhuck, Tuesday, 4 April 2006 13:26 (nineteen years ago)
― xhuck, Tuesday, 4 April 2006 14:56 (nineteen years ago)
― pdf (Phil Freeman), Tuesday, 4 April 2006 16:56 (nineteen years ago)
― xhuxk, Tuesday, 4 April 2006 20:23 (nineteen years ago)
howlin' wind (on birdman) -- more amorphous dweebs (comets on fire connected, i think? not that i hate comets on fire, honest) who grew up on alt-indie and heard last year that southern boogie is the place to go but don't know how. actually, i kind of like this. singer has some humble pie (warmed by canned heat) in his voice even if i can't usually get the words, and the songs are noisy but tuneful and have a groove to them. maybe the songs per se' will sink in eventually too.
scar symmetry (on nuclear blast) - thrash noise with melodies, power metal ones i guess. has definite possibilities. need to listen more.
― xhuxk, Wednesday, 5 April 2006 13:26 (nineteen years ago)
I also dig the new one by Abysmal Dawn. Trad Florida-style death. No reinvention of wheels. Just death, death, & more death.
Hey Xhuxk, did you contact the dude from Napalm? I can give him yer e-mail if you want. You need the Korpiklaani in your life.
― scott seward (scott seward), Wednesday, 5 April 2006 13:51 (nineteen years ago)
and yeah scott, i emailed the napalm guy! he was really nice; says he's sending me all three albums you mentioned, korpiklaani included. i can't wait! (am awaiting madder mortem and lacuna coil from other folks, too.)
― xhuxk, Wednesday, 5 April 2006 13:56 (nineteen years ago)
― xhuxk, Wednesday, 5 April 2006 14:38 (nineteen years ago)
― pdf (Phil Freeman), Wednesday, 5 April 2006 15:04 (nineteen years ago)
new buckcherry is a keeper, by the way. did i establish that before? two best songs are the same two i mentioned way upthread, about bitches and brooklyn. but it plays end to end real likeably. even the ballads.
― xhuxk, Wednesday, 5 April 2006 15:12 (nineteen years ago)
― xhuxk, Wednesday, 5 April 2006 15:20 (nineteen years ago)
― xhuxk, Wednesday, 5 April 2006 15:50 (nineteen years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Wednesday, 5 April 2006 17:00 (nineteen years ago)
i liked the burst album! much more than their last album. and it's not all noisy and screamy. i thought they mixed things up nicely. and, yeah, i think it was pretty popular.
― scott seward (scott seward), Wednesday, 5 April 2006 17:09 (nineteen years ago)
But I was convinced it was something for the extreme metal fan to tide over until the next one.
Downloaded Tommy Conwell's pre Hi Ho Silver, Sho Gone Crazy, and there's another Johnny Thunders/Heartbreakers cover on it, "Let Go." And I pretty much like it as much as Hi Ho Silver. Not as much punk rock cover, more trashcan shuffle boogie and we're having a real rock and roll party and jolly good time. And his entire indie Walk On Water release which sold 70,000 locally in 85 or so is available off his fan page for free, but it's not metal, so probably here nor there. Reminds me of why I liked quite a few of the 80's Philly classic rock bands, though.
― George 'the Animal' Steele, Wednesday, 5 April 2006 18:05 (nineteen years ago)
Lucas McCain, *New Horizon,* yet another excellent cdbaby Southern rock/country-metal album (from Georgia this time) nobody's gonna care about but me and George, though others should. 2006 copyright, too! Anyway, a brief rundown: "New Horizon" (Skynyrdesque gimme-three-steps boogie woogie, they totally know how to dance), "Long Hot Summer Night" (Mellencamp/Adams '80s-style words, riff somewhere between "Run to You" and "Money for Nothing" but heavier + more boogiefied), Home On their Minds" (lament honoring the troops, hoping for peace in a strange land with death all around them), "Gimme Some of That" (funky rock namedropping Bocephus and Skynyrd and saying no-sell-out and we miss that old time rock and roll it's the music that saves our soul), "One Bad Love (Don't Make It Bad)" (divorce lament suggesting, no kidding, John Conlee leading the Marshall Tucker Band), "Does Anybody Care" (gutbust lament where the vocal verges into Eddie Vedder territory though that's just 'cause, as I believe Frank Kogan observed in *Radio On* many years ago, Vedder sang like David Clayton-Thomas; beautiful twin-guitar ending), "Concrete Cowboy" (Charlie Daniels doing "Legend of Wooley Swamp"-style rapneck), "Working on Tomorrow" (riff recalling Eddie Money's "I Think I'm in Love" only heavier.) And there's a couple other songs too (and many other lovely guitar parts).
― xhuxk, Wednesday, 5 April 2006 19:34 (nineteen years ago)
― xhuxk, Wednesday, 5 April 2006 19:38 (nineteen years ago)
And The Last Vegas's Seal the Deal arrived. Ramalamma garage metal that starts with a song that sounds like Aerosmith and then goes off in its own direction. Finale of album is some nightmarish concept opera thing called "King the Red Light" which puts a capper on the last four tunes which pound just fine. And, to tell the truth, I have no idea what the guy is singing about.
Some Motley Crue comparisons in the press although I suspect I'd like them less if they actually sounded like that. Pretty much their own street rock animal.
― George 'the Animal' Steele, Wednesday, 5 April 2006 23:51 (nineteen years ago)
― baby, disco is fuck (yournullfame), Thursday, 6 April 2006 12:44 (nineteen years ago)
― xhuxk, Thursday, 6 April 2006 13:41 (nineteen years ago)
The Lehigh Valley also had one of the larger distributors of Xtian metal and hard rock. I did a story on the label for the local paper. Local-local-local, it was the kind of thing the editors loved. Sadly, all the music was horrible.
There was one Xtian metal band whose record I wish I still had: Vicious Barreka's Outrage, Profanity & Insanity. There was no profanity on the album, or much insanity and outrage. It was an Allentown/Bethlehem band with a tonedeaf singer who recognized his limitations and essentially chanted his lyrics to songs like "Heavenly Metal" which originated a unique rapping style I've never heard duplicated. Unique style in this case did not mean a great record, it just means like no other. We played with them a few times at the Airport Music Hall so I knew the material well. Can still hear some of it in my head.
― George 'the Animal' Steele, Thursday, 6 April 2006 18:58 (nineteen years ago)
― ng-unit, Thursday, 6 April 2006 19:53 (nineteen years ago)
because i'm listening to it and it's pretty damn good. saying "it's the best thing they've done since pandemonium" may not sound like much but i'm not ready to say it's their best ever. but fuck, man, they manage to advance their sound convincingly. for some reason i keep wanting to compare it to blood inside, don't know why.
― baby, disco is fuck (yournullfame), Friday, 7 April 2006 07:34 (nineteen years ago)
― scott seward (scott seward), Friday, 7 April 2006 12:18 (nineteen years ago)
Nah, not in the index. And only one passing mention of King's X, which seems odder, since I think King's X actually did conentrate initally on a Christian rock audience (or, at least, Pinnick had definitely been in bands that did so before, right?) Trouble might be more like the Alarm or Call or Chevelle, in that they're just guys in a band who happen to be Christian. But their audience is a metal audience, not a Christian one. Though I may be wrong about that. (I actually had no idea Chevelle, who if I've ever heard them I have no memory of it, were ever a Christian band. Though apparently they were. And maybe they *did* once have a largely Christian audience; I'm not sure. Evanescence and P.O.D. and Switchfoot did, apparently.)
>AAA are nowhere near as good as Propagandhi<
What about Anti-Flag? (That was the third band my daughter really seemed to like during her fortunately extinct agit-prop punk phase.)
― xhuxk, Friday, 7 April 2006 12:23 (nineteen years ago)
― scott seward (scott seward), Friday, 7 April 2006 12:30 (nineteen years ago)
― scott seward (scott seward), Friday, 7 April 2006 12:34 (nineteen years ago)
― scott seward (scott seward), Friday, 7 April 2006 18:34 (nineteen years ago)
The Don Cab is surprisingly good. The other 2 I am desperate to hear.
― Brigadier Lethbridge-Pfunkboy (Kerr), Friday, 7 April 2006 18:39 (nineteen years ago)
I bought it. I think its terrific. Played it an awful lot.
― Brigadier Lethbridge-Pfunkboy (Kerr), Friday, 7 April 2006 18:42 (nineteen years ago)
Xhuxk, you gonna be at the Buckcherry show on Tuesday? Oh, and I think I'm going to start calling you "Buckcheddy" from now on. ;)
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Friday, 7 April 2006 18:49 (nineteen years ago)
― scott seward (scott seward), Friday, 7 April 2006 19:19 (nineteen years ago)
― pdf (Phil Freeman), Friday, 7 April 2006 19:28 (nineteen years ago)
― ng-unit, Friday, 7 April 2006 19:58 (nineteen years ago)
And Scott - thanks for the Napalm folke-metale tips! I am definitely liking Korpiklaani and Falkenbach! What's a little odd about Korpiklaani is that, initially with the album's first song, I'm not buying their oompah credentials; the rhythm pogos a wee bit too much like ye olde hardcorps hopscotch for its own good. But by the second song goofy sounds are coming in, and the Finnish folkstuff really blossoms beautifully after that, especially in "Spring Dance." Next time through, "Happy Boozer" probably won't bug me at all! As for Falkenbach, I'm not even sure how I'd classify them -- First song "Heathen Foray" soars almost like Hawkwind or something, and "Roman Land" is really cool and weird in a way I forgot to write down, and by "Skirnir" at the end they are doing an oompah loompah doompah dee doo chant. Plus they toss all kinds of folk stuff in too. Tyr on now, and they *also* sound great. (The melody for their second song keeps turnning into "God Rest Ye Merry Gentlemen," David Banner's favorite Christmas carol I think!) Damn, I hope Napalm keeps me on their list!
― xhuxk, Friday, 7 April 2006 20:06 (nineteen years ago)
― xhuxk, Friday, 7 April 2006 20:13 (nineteen years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Friday, 7 April 2006 20:19 (nineteen years ago)
Now Tyr are signing in another language! Except their name isn't really Tyr, is it? The middle letter is some foreign thing that looks like an upside down pitchfork or Neptune's trident, more than a Y. (Also, did somebody say this CD is a reissue? Are any of the other Napalm ones?)
― xhuxk, Friday, 7 April 2006 20:23 (nineteen years ago)
― scott seward (scott seward), Friday, 7 April 2006 20:30 (nineteen years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Friday, 7 April 2006 20:43 (nineteen years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Friday, 7 April 2006 20:45 (nineteen years ago)
― a. begrand (a begrand), Friday, 7 April 2006 20:58 (nineteen years ago)
― xhuxk, Friday, 7 April 2006 21:57 (nineteen years ago)
― xhuxk, Friday, 7 April 2006 22:03 (nineteen years ago)
Also seems to have something to do sonically with Kings of the Sun and the personal vocal style of Angel City's Doc Neeson. (Or the Angels as she'd call them.)
Oh boy, now there's a great pumping roadhouse organ -- or old timey skate rink -- on "Be With You." Lots of crunch on the guitars and bass.
Tommy James-style "Crimson & Clover" tremolo on "So Long." Boy, along with the old Conwell CDs, a history book of classic radio ready guitar licks and roughed-up and dirty pop rock singing.
― George 'the Animal' Steele, Friday, 7 April 2006 22:26 (nineteen years ago)
http://www.theendrecords.com/label/var/altend/
01: Voivod - The X-Stream* album: Katorz (The End)02: The Gathering - Shortest Day album: Home (The End)03: Green Carnation - Alone album: The Acoustic Verses (The End)04: Head Control System - Wonderworld album: Murder Nature (The End)05: Giant Squid - Neonate* album: Metridium Field (The End)06: Agalloch - Falling Snow* album: Ashes Against The Grain (The End)07: Virgin Black - Adelaide Symphony Orchestra sessions** album: Requiem (The End)08: Sleepytime Gorilla Museum - Sleep Is Wrong album: Grand Opening And Closing (reissue) (The End)09: Dissection - Starless Aeon album: Reinkaos (The End)10: Unexpect - Megalomaniac Trees album: In A Flesh Aquarium (The End)11: Thine Eyes Bleed - Cold Victim album: In The Wake Of Separation (The End)12: Sadus - Sick album: Out For Blood (Mascot)13: Impaled Nazarene - For Those Who Have Fallen album: Pro Patria Finlandia (Osmose)14: Laethora - Black Void Remembrance * album: March Of The Parasite (Unruly Sounds)15: Yyrkoon - Signs album: Unhealthy Opera (Osmose)* denotes alternate mix and will differ from album version** string excerpts. full instrumentation not represented
― DJ Martian (djmartian), Friday, 7 April 2006 22:27 (nineteen years ago)
― scott seward (scott seward), Saturday, 8 April 2006 02:22 (nineteen years ago)
― xhuxk, Saturday, 8 April 2006 14:28 (nineteen years ago)
― scott seward (scott seward), Saturday, 8 April 2006 14:40 (nineteen years ago)
! ! !
― Ian Christe (Ian Christe), Saturday, 8 April 2006 17:58 (nineteen years ago)
baron zen, *at the mall* wanted to like this. reissued old (early '90s i think) nerdcore band of undie rapper peanut butter wolf, whose later stuff i've liked OK. they cover joy divison, debbie dub ("lookout weekend"!), katrina and the waves, plus "burn rubber on me," the gap band's best and most underrated song. and they do silly originals about shoes, going to the mall, spending the night in jail. sounds potentially fun on paper (and the press release's missing-link-between-PiL-and-DFA-or-whatever lies seemed promising), but i just can't past the inept, anorexic sub-dead milkmen/atom & package geekiness of it all.
― xhuxk, Saturday, 8 April 2006 18:51 (nineteen years ago)
― xhuxk, Saturday, 8 April 2006 18:52 (nineteen years ago)
― scott seward (scott seward), Saturday, 8 April 2006 19:00 (nineteen years ago)
I sent a review of Falkenbach to The Wire awhile ago, but they changed reviews editors and consequently never ran it. My write-up on Craft's Fuck The Universe is in the new issue, though.
― pdf (Phil Freeman), Saturday, 8 April 2006 19:18 (nineteen years ago)
― scott seward (scott seward), Saturday, 8 April 2006 19:21 (nineteen years ago)
Okay, that is pretty funny, I admit it. (But nobody send me *Decibel* anymore:(
And I still can't find my Tyr CD, damn!
― xhuxk, Saturday, 8 April 2006 19:24 (nineteen years ago)
"Ah, so it's our old friend, the Craw!" should have been the caption. These samples are funnier and short:
http://www.geocities.com/televisioncity/lot/6682/sound.html
The two at the top of the page, each a couple seconds long.
― George 'the Animal' Steele, Saturday, 8 April 2006 19:29 (nineteen years ago)
Good one on Pentagram in the Voice by pdf, too. And Flyleaf I still haven't heard.
― George 'the Animal' Steele, Saturday, 8 April 2006 19:50 (nineteen years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Saturday, 8 April 2006 20:22 (nineteen years ago)
http://store.decibelmagazine.com/images/Product/large/38.jpg
― a. begrand (a begrand), Saturday, 8 April 2006 20:30 (nineteen years ago)
― George 'the Animal' Steele, Saturday, 8 April 2006 21:26 (nineteen years ago)
Yep, I think that's what the label called it. It's on now and it's quite beautiful: glacially slow and ringing sad-howling-behemoth-lost-in-forest-beating-on-drums music. If I heard it on my own, I don't think I'd classify it as "black metal," but what do I know? Pagan for sure. Sort of a cross between Laibach and Carnival of Coal, but without the goofy cover versions!
― xhuxk, Sunday, 9 April 2006 18:06 (nineteen years ago)
― xhuxk, Sunday, 9 April 2006 18:11 (nineteen years ago)
― xhuxk, Sunday, 9 April 2006 19:29 (nineteen years ago)
― scott seward (scott seward), Sunday, 9 April 2006 20:19 (nineteen years ago)
Anyway, with Vikernes about to be released (April 2006 was the last date I heard), things could become interesting the coming months on the Burzum front (no pun intended obv). Last december he announced that he planned to record a new album roughly in the style of Filosofem ASAP and Candlelight Records (the new owners of the orphaned Misanthropy back catalogue) seems to be the label of choice.
But then again, backtracking on past claims is his trademark, so this might all be way premature.
― Siegbran (eofor), Sunday, 9 April 2006 20:42 (nineteen years ago)
Dol Guldur
Dol Guldur is a refinement of the sound first developed on Minas Morgul and an excellent album in its own right. It is less metallic and a great deal more ambient than its predecessors, at once bombastic and atmospheric. The album effectively invokes Tolkien's Middle Earth, with an approach so primitive and haunting that the listener is instantly transported far away into pastoral valleys, primordial ravines, and dark secretive forests. The music seems somehow ancient, invoking long buried memories and a genuine feeling of nostalgia and mystery. Dol Guldur is less about music in and of itself, and more about an experience, about a place in the darker recesses of the mind.
The music is not metal so much as ambient trance music with metal elements. The guitar lines are simple tremolo chords sustained and distorted to the point of transcending conventional metal and becoming ambient noise. Hovering over this noisy ambience are melody lines provided by keyboard; the keys are primarily used to imitate classical/medieval instruments and sail in layers of quasi-medieval polyphony over the haze of white noise. All of this is tethered to heavy beats provided by a drum machine, programmed to sound like hand drums, tympani percussion and blocks; these beats are often syncopated and layered in intricate poly-rhythms. Vocals are shrieked and rasped, soaring over the music in long, sustained breaths. The music is repetitious, with songs over ten minutes comprised of little more than a single riff or melody line.
All of the lyrics present on Dol Guldur are based on the works of J.R.R. Tolkien with many lines and verses taken directly from the poetry and songs of Middle Earth. Unlike bands like Blind Guardian (who also base their lyrics off of Tolkien's writings), Summoning invokes something deeper and more enduring in Tolkien's work, the darkness and mystery at the heart of The Lord of the Rings. Summoning's music wraps the listener in its haunting majesty, lulling the listener into its web-like trance with epic song structures and spidery melodies. Rather than clobber the listener over the head with tales of chivalry and heroism, Summoning create an ethereal atmosphere and draws the listener into a world both familiar and alien through deep, hypnotic textures.
Nightshade Forests
Arguably the best material ever released by trance metal gurus Summoning, the thirty-four minute Nightshade Forests EP stands as their least metallic and most ambient work yet. Comprised of four epic songs, the music forgoes the heavy rhythm guitar and hectic compositions of black metal and is dependant instead on drum loops, programmed polyphony, very repetitious song structures and hazy ambience. The guitar lines have been reduced (by their production and execution) to wispy sheets of white noise floating between the keyboard melodies and heavy, often syncopated beats. The melody lines are twisting, hypnotic affairs, almost instantly triggering associations in my mind with Celtic New Agers Ceredwen. The melodies, infectious and repeated for minutes on end, have a way of seeping into one's mind and resurfacing in memory at unexpected moments weeks later.
Music like this will simply be unacceptable to the die hard "true metal" fanatic (you know, the guy who lives for Manowar concerts, collects seven inches of bands called Goatfuck, and thinks Dark Tranquillity are sellouts etc.), but for anyone moderately interested in ambient trance music with a dark fantasy theme, Nightshade Forests is a solid release. "Kortirion among the trees" might very well be the best song Summoning has ever produced, with its thick ambient wash, dub-like breaks and serpentine melody-lines. Anytime I play this album, no matter what I'm doing at the time, I find myself totally immersed in the experience. I had to turn the album off half way through writing this review, as I found myself ensnared in its tapestry of sound and unable to concentrate on the writing process. It's just one of those albums.
― James Slone (Freon Trotsky), Sunday, 9 April 2006 20:57 (nineteen years ago)
― Siegbran (eofor), Sunday, 9 April 2006 21:07 (nineteen years ago)
siegbran, do you like anything on the falkenbach dude's label, skaldic art? rivendell? obsidian gate? i've never heard any of them. i was wondering if any of the bands are worthwhile. i dig HIS music, so i figure he must have an ear for other good stuff.
― scott seward (scott seward), Sunday, 9 April 2006 21:20 (nineteen years ago)
― Siegbran (eofor), Sunday, 9 April 2006 21:33 (nineteen years ago)
― scott seward (scott seward), Sunday, 9 April 2006 21:39 (nineteen years ago)
― xhuxk, Sunday, 9 April 2006 22:38 (nineteen years ago)
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Monday, 10 April 2006 13:48 (nineteen years ago)
haha, i was gonna say strippers! - his core audience for years - but then i saw your pole dance remark. you beat me to it. i had an ex-girlfriend who was a stripper who always went with rob when she needed the big tips. either him or "hey man, nice shot".
― scott seward (scott seward), Monday, 10 April 2006 15:22 (nineteen years ago)
― xhuxk, Tuesday, 11 April 2006 17:36 (nineteen years ago)
― George 'the Animal' Steele, Tuesday, 11 April 2006 20:16 (nineteen years ago)
http://cdbaby.com/cd/dirtybirds
― xhuxk, Tuesday, 11 April 2006 20:45 (nineteen years ago)
yeah, nuclear war now did that, which is slightly odd given their general proclivity for raw thrash/black/death metal. great label. they're reissuing the reencarnacion anthology (raw colombian death/thrash) as a 2lp and the root demo collection as a fucking 4-lp box. fetsh object or what.
― baby, disco is fuck (yournullfame), Tuesday, 11 April 2006 22:35 (nineteen years ago)
>Just got the Kalas CD in the mail. Why would you let Matt Pike be in your band and only do vocals? Matt Pike has good qualities, but his voice is not one of them.
― pdf (Phil Freeman), Wednesday, 12 April 2006 00:11 (nineteen years ago)
― xhuxk, Wednesday, 12 April 2006 13:37 (nineteen years ago)
― xhuxk, Wednesday, 12 April 2006 15:27 (nineteen years ago)
It was a tough guy cigar-smokin' trio on the back cover. Good singer, technically chopsy but not so it ruined anything. Tight, precise, fast. Have no idea what they sound like now but this makes me want to go and drag out Perfect Man. I suspect it was one of their highpoints. Band of similar tonal ilk who never wrote anything as remotely catchy as "Sinister Thinking" (probably because they didn't have a 'singer') was Coroner.
I liked my Coroner records more but Rage were often found playing on the stereo the same day.
― George 'the Animal' Steele, Wednesday, 12 April 2006 15:47 (nineteen years ago)
― xhuxk, Wednesday, 12 April 2006 16:09 (nineteen years ago)
― scott seward (scott seward), Wednesday, 12 April 2006 16:25 (nineteen years ago)
― scott seward (scott seward), Wednesday, 12 April 2006 16:26 (nineteen years ago)
― pdf (Phil Freeman), Wednesday, 12 April 2006 16:35 (nineteen years ago)
― xhuxk, Wednesday, 12 April 2006 17:02 (nineteen years ago)
six organs of admittance press release compares them to popul vuh (who i've never heard, though i've always wondered about ever since kids on my high school newspaper used to mention him 30 years ago, was he* any good? kinda assumed he'd been boring but maybe not) and hapshash and the coloured coat (yeah right, not that they were that good in the first place.) i'm assuming that's bullshit, but if somebody swears i should play this six organs thing, i guess i will.
* -- or "they"? for all i know, popul vuh was more than one guy!
― xhuxk, Wednesday, 12 April 2006 17:25 (nineteen years ago)
Popol Vuh was a band. I only know the music they did for Werner Herzog movies like Aguirre, The Wrath Of God and Nosferatu The Vampyre and probably a couple of others, too. Spooky prog with occasional flutes, as I recall.
― pdf (Phil Freeman), Wednesday, 12 April 2006 17:28 (nineteen years ago)
― xhuxk, Wednesday, 12 April 2006 18:17 (nineteen years ago)
― xhuxk, Wednesday, 12 April 2006 21:14 (nineteen years ago)
― George 'the Animal' Steele, Wednesday, 12 April 2006 22:05 (nineteen years ago)
and cult of luna are NOT as good as neurosis! Phil is crazy too!
And Tucky Buzzard were great! oh, wait, george said he liked them. But he's still crazy!
― scott seward (scott seward), Wednesday, 12 April 2006 22:06 (nineteen years ago)
― scott seward (scott seward), Wednesday, 12 April 2006 22:08 (nineteen years ago)
― scott seward (scott seward), Wednesday, 12 April 2006 22:31 (nineteen years ago)
"So it is you, Hoo!"
"I see we meet again Mist-ah Craw..."
"Craw, not Craw, Craw!?!"
― The Amazing Harry Hoo, Wednesday, 12 April 2006 22:58 (nineteen years ago)
― pdf (Phil Freeman), Thursday, 13 April 2006 13:17 (nineteen years ago)
Iron Fire's Revenge also worked because the singer is an -- uh -- rock singer who sometimes sounds like guys from Styx and sometimes Jon Bon Jovi. And mostly Iron Fire sounds like early Styx which makes the record good, much better than average. Songs -- rocking, somewhat midwestern among the strains of Euro * Manowar power metal. Tuneful, and the titles are easy to pick out of the songs which is a plus.
Things I'm suspicious are bad bets --Naio SSaion (name too much like the hiss of a garter snake) and Summoning because without a cue card you can't tell what their logo actually spells. Art's cool, though, reminding me of something, maybe an Harvey Mandel record.
― George 'the Animal' Steele, Saturday, 15 April 2006 19:20 (nineteen years ago)
― George 'the Animal' Steele, Sunday, 16 April 2006 16:01 (nineteen years ago)
'rok' plays fiddle in the role of the fiddle-player in Kansas, he's kind of Euro, kind of bluesy, kind of poppy, everything any particular song needs. Lots of tunes to draw you in, usually about everyday things like telling someone to shup up and girl empowerment.
And Iron Fire's Revenge continues to be a repeat play.
― George 'the Animal' Steele, Sunday, 16 April 2006 18:22 (nineteen years ago)
The Summoning sound like they would be better doing opera in an actual theatre where you could look at people engaging with sets and each other for this type of thing.
― George 'the Animal' Steele, Sunday, 16 April 2006 21:23 (nineteen years ago)
Sinamore's A New Day is ready for American theatre and stadium pop Goth metal on the undercard of HIM bills. And boy is autotune all over the singer's voice, just the way they like it on radio. Easy listening teen melancholia metal, pro-tooled for the market, but not as good as Naio SSaion.
Kampfar's Kvass: What's a Kampfar? Something you roast marshmallows over! And the jokes stop there because I have no idea what the trolls are on about. Last tune, "Gaman Av Drommer," would be an anthem if they found someone other than the troll to sing it.Mildly entertaining for a few moments but probably no return gigs, thank you.
And Falkenbach, about whom much has already been said, float my boat.
― George 'the Animal' Steele, Monday, 17 April 2006 00:30 (nineteen years ago)
― scott seward (scott seward), Monday, 17 April 2006 00:45 (nineteen years ago)
I couldn't stand the album, and I'm sympathetic to power metal. I found the Manowar goofiness borderline unbearable. Plus, the singer tries waaay too hard with the cock rock vocal cliches. Edguy does the circa 1985 metal thing so much better on their new one, which is shaping up to be one of my 2006 faves.
Oh, and that new Korpiklaani is killer. Here's some folk metal I can like, a band that is unafraid to have some fun every once in a while.
― a. begrand (a begrand), Monday, 17 April 2006 07:29 (nineteen years ago)
― George 'the Animal' Steele, Monday, 17 April 2006 16:01 (nineteen years ago)
― George 'the Animal' Steele, Monday, 17 April 2006 16:16 (nineteen years ago)
― George 'the Animal' Steele, Monday, 17 April 2006 16:23 (nineteen years ago)
― Tom B III, Monday, 17 April 2006 16:39 (nineteen years ago)
― latebloomer's jazz oddysey brought to you by kellog's corn flakes (latebloomer), Monday, 17 April 2006 16:41 (nineteen years ago)
Because I thought it would bug you or someone else. Hey, it's not my term, I'm only abusing it. Look upthread.
WHO FUCKING CARES!? is more emphatic.
― George 'the Animal' Steele, Monday, 17 April 2006 17:44 (nineteen years ago)
now you know why i have a hard time listening to people rave about stuff like the darkness. not that anyone really raves about them anymore, but insert band du jour of your choice.
― scott seward (scott seward), Monday, 17 April 2006 20:20 (nineteen years ago)
― George 'the Animal' Steele, Monday, 17 April 2006 20:50 (nineteen years ago)
― don, Tuesday, 18 April 2006 04:03 (nineteen years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Tuesday, 18 April 2006 08:00 (nineteen years ago)
― CHRIS MOLTISANTI, Tuesday, 18 April 2006 16:53 (nineteen years ago)
Now, what the hell, I should listen to Hurtlocker. Yugg, not promising. Reminds of Relapse stuff from about two years ago -- Uphill Battle, Dillinger without as much math, stupid and apoplectic tough guy vocals, too much double bass frash, third song sounds like first song only twice as fast, let's fight -- rahhhhhh, fuck yuuuuuuu, spittle flying, molars rattling, fukk yu your bullshidt, big guitar whonng, deedley-deedley-dee, more rahhhhhhh, a really long rahhhhhhhhhh, metalcore steroid muscle, swing for the fence every tune EJECT. That's that.
― George 'the Animal' Steele, Tuesday, 18 April 2006 18:46 (nineteen years ago)
― don, Tuesday, 18 April 2006 19:08 (nineteen years ago)
At the time of the invention of the dongle the network didn't exist like it does now. So it's easy for vendors to provide dongle-like administration by requiring you to be on-line to 'register' for various updates and continuances of services.
Refreshingly, the Napalm promos came with the old CD Standard disc certification stamped on them meaning, unless they're committing fraud, there is nothing on them but music tracks in the standard format. I've haven't seen that insignia in awhile on big product.
― George 'the Animal' Steele, Tuesday, 18 April 2006 20:09 (nineteen years ago)
Joan Jett should get interested in Atomic Bitch rather than that gobbling by-the-numbers-only-the-numbers-are-ones-you-always-hated Clevo-punk band, The Vacancies, I tell ya.
― George 'the Animal' Steele, Tuesday, 18 April 2006 20:37 (nineteen years ago)
― Brian O'Neill (NYCNative), Wednesday, 19 April 2006 04:04 (nineteen years ago)
In metal news of a more personal nature: I am finally getting a byline in Kerrang! in a week or so. And I got a bunch more assignments too. This pleases me to no end. Between that and another outlet giving me the time of day after a long lay off (hopefully assignments will follow), I feel like an actual writer again.
― Brian O'Neill (NYCNative), Thursday, 20 April 2006 10:58 (nineteen years ago)
― pdf (Phil Freeman), Thursday, 20 April 2006 14:22 (nineteen years ago)
― Brian O'Neill (NYCNative), Thursday, 20 April 2006 17:25 (nineteen years ago)
― Brian O'Neill (NYCNative), Thursday, 20 April 2006 20:37 (nineteen years ago)
― Brian O'Neill (NYCNative), Thursday, 20 April 2006 20:40 (nineteen years ago)
http://concreteplanet.com/newsletter/MetalDVDweb.jpg
― Brian O'Neill (NYCNative), Thursday, 20 April 2006 21:28 (nineteen years ago)
― Siegbran (eofor), Friday, 21 April 2006 08:17 (nineteen years ago)
― a. begrand (a begrand), Friday, 21 April 2006 09:10 (nineteen years ago)
― josh in sf (stfu kthx), Friday, 21 April 2006 16:46 (nineteen years ago)
Lacuna Coil piece inside the LA Times Calendar section today. The new album entered Billboard around or at 25, can't recall. And their Comalies record was Century Media's best seller, evah, according to the article. Photo has 'em not looking very Gothy, especially Scabbia would double as a ringer for any fem singer in an 80's new wave/hard rock band. Not a bad look if you must have one. She drily remarked on being in the photospread for Revolver's 'hot chicks' thing mentioned upstream. "Better me than another drunken guy," or something to that effect, since I'm paraphrasing with quotations.The logic of it is inescapable.
And I found great use for The Summoning's Oath Band. Nothing worked on the stereo during the Eddy debacle except Oath Bound. Whether by coincidence or not, I'm a fan. Now it'll be the go to soundtrack record for awhile whenever I'm in a shitty mood that needs some kind of loud music that isn't rock 'n' roll.
― George 'the Animal' Steele, Saturday, 22 April 2006 18:08 (nineteen years ago)
― xhuxk, Saturday, 22 April 2006 23:37 (nineteen years ago)
amen to that. i don't know what to listen to tonight. i've got the whole house to myself, kinda. maria is out. the kidz are in bed. nothing too loud though. been thinking of you all week, chuck. kinda crazy really. i never think of people that much. i'm usually very selfish in my thoughts. monday i have to go get a physical and probably drug tested for my janitor job at the hospital.
― scott seward (scott seward), Sunday, 23 April 2006 00:24 (nineteen years ago)
― don, Sunday, 23 April 2006 00:32 (nineteen years ago)
― don, Sunday, 23 April 2006 00:49 (nineteen years ago)
anyway, here is yolanda thomas. and come to think of it, "oh yes" probably has a wee bit too much melissa etheridge in it for its own good, and the gloria-estefan-via-shakira move "perception of deception" is probably more fun. vibratophobes, caveat emptor. but "lock up your sons" and "going down" are truly rockin' and sexy and really crack me up:
http://cdbaby.com/cd/yolandat
and wolfgang bang, who turn out to be from el lay not joyzy, are here:
http://cdbaby.com/cd/wolfgangbang
and the 2 CDs i hoped i'd like today but didn't were life on mars's *life on mars* ('80s heart/branigan revival sans melodies or production) and evil beaver's *models of virtue* EP (tuneless post-post-post frightwig riot grrrly sludge w/ lame "i wanna be your dog" cover)
and these are the vinyl albums i bought in seattle last weekend (about $27 total, if i remember right, though i could've saved a bunch if i'd bought screaming blue messiahs later in the afternoon at the used store i went to instead of at a flea market earlier):- dissidenten *sahara electric* (1988, morrocan-german dance fusion; i liked this once.)- focus *ship of memories* (1976, an odds and sods compilation i guess, maybe?)- max webster *live magnetic air* (1975, excellent hockey prog cover art)- mott *drive on* (1975, post-ian hunter, and i just noticed the vinyl is badly scratched)- screaming blue messiahs *gun shy* (1986, i think frank black stole the singer's haircut)- slik *slik* (1976, on arista records, and totally fucking mysterious. who the hell are these guys? they name one song "the kid's a punk" but at best they only look like punks in the *lords of flatbush*/dion and the belmonts sense, except they're all wearing different baseball jerseys on the cover. and really short greasy hair. you know they're tough guys 'cause the one with the springsteen/deniro/pacino look has a toothpick in his mouth and another one is punching his left palm with his right fist. they cover both "when will i be loved" by the everly brothers and "bom bom" by exuma, the latter of which i'm pretty sure was also covered by the jimmy castor bunch, and they also do a song called "do it again" credited to midge ure, though ultravox didn't put out their first album until 1977 I think. also, there's a song called "dancerama." so maybe they're disco? i have no idea, not yet.)
finally, one more thing: i wish everybody would stop being so damn glum around here...
― xhuxk, Sunday, 23 April 2006 01:12 (nineteen years ago)
Out of curiosity (hope this isn't a dumb question) but the byline for the article on the metal DVD is Cheryl Eddy. Any relation?
― Brian O'Neill (NYCNative), Sunday, 23 April 2006 01:18 (nineteen years ago)
oops, forgot 3 other LPS i bought (also part of the same $27 or so, though i should note that that figure might be somewhat off, as last sunday seems like a long time ago already):
- steeleye span, *all around my hat* (1975, reportedly one of their more rocking efforts)- zz top, *el loco* (1981, their weirdest and most new wave LP, why'd i ever get rid of it?)- *KZOK Best of the Northwest 1981* (11 bands i never heard of before, many seemingly rocking from their descriptions on the cover. The Cowboys ["a dynamic rock band from Seattle" who "play passionate non-stop dance music," cool!} cover *In the Midnight Hour*, and Legs, who are compared to AC/DC/Trower/early Zep with a Joplinesque singer, cover *30 Days in the Hole.* And post-new-wave '81 was a fine year for catchy hard rock, so...)
― xhuxk, Sunday, 23 April 2006 01:20 (nineteen years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Sunday, 23 April 2006 01:22 (nineteen years ago)
― don, Sunday, 23 April 2006 01:47 (nineteen years ago)
― xhuxk, Sunday, 23 April 2006 02:20 (nineteen years ago)
― don, Sunday, 23 April 2006 03:06 (nineteen years ago)
― don, Sunday, 23 April 2006 03:18 (nineteen years ago)
http://alexgitlin.com/npp/slik.htm
http://www.answers.com/topic/slik
― xhuxk, Sunday, 23 April 2006 03:38 (nineteen years ago)
Tried playing the new Yyrkoon before that. I *liked* their last one. Or at least I convinced myself I did, at the time. Can't remember why. Or maybe I'm no longer in the mood for extended ambient monster vomit muzak. (Quiz: who' s more "sci-fi", Zombi or Yyrkoon?)
― xhuxk, Sunday, 23 April 2006 05:05 (nineteen years ago)
― latebloomer (latebloomer), Sunday, 23 April 2006 05:55 (nineteen years ago)
― latebloomer (latebloomer), Sunday, 23 April 2006 05:57 (nineteen years ago)
>wolfgang bang ...add up to the punk rock album of the year so far i think, sorry dc snipers, unless i forgot one,<
well, i forgot red swan, and black angels, and kill cheerleader, and - duh! - atomic bitch and leanne kingwell, the latter two of which have shots at my top ten if i'm allowed to make one this year whereas all those others aren't even close. but still, i think there's a way that wolfgang bang (and dc snipers) are more *emotionally* punk (in the search and destroy passersby in suburbia sense) than most of these other guys and especially gals. (& korpiklaani sound kinda punk sometimes too, don't they? and they're way up there too.)
>yolanda thomas.. is almost as good as leanne kingwell in her horniest songs<
nah, that "almost" is kinda hyperbole. i pulled leanne's album back out last night and it blew me away again; yolanda's cool, but she can' touch it. (though i would say that i probably like yolanda's two best songs more than leanne's ballads, which is something.)
― xhuxk, Sunday, 23 April 2006 12:11 (nineteen years ago)
And one of these days I will get a copy of *No B.S.*! But I'm not gonna buy it on cd. That would be sad.
― scott seward (scott seward), Sunday, 23 April 2006 14:05 (nineteen years ago)
― scott seward (scott seward), Sunday, 23 April 2006 14:15 (nineteen years ago)
Best of luck for the future chuck.
― Brigadier Lethbridge-Pfunkboy (Kerr), Sunday, 23 April 2006 14:26 (nineteen years ago)
― scott seward (scott seward), Sunday, 23 April 2006 14:27 (nineteen years ago)
― scott seward (scott seward), Sunday, 23 April 2006 14:28 (nineteen years ago)
― scott seward (scott seward), Sunday, 23 April 2006 14:30 (nineteen years ago)
― scott seward (scott seward), Sunday, 23 April 2006 14:45 (nineteen years ago)
Yes!
― Brigadier Lethbridge-Pfunkboy (Kerr), Sunday, 23 April 2006 14:55 (nineteen years ago)
― xhuxk, Sunday, 23 April 2006 16:04 (nineteen years ago)
― xhuxk, Sunday, 23 April 2006 16:26 (nineteen years ago)
― scott seward (scott seward), Sunday, 23 April 2006 16:33 (nineteen years ago)
Focus' Ship of Memories is exactly as you suspect. It's fair. And the reason you were able to snag the Mott album sans Hunter was precisely because it was scratched, I bet. Collectors seem awful fond of it now but I never thought it sounded that good. You can get the basic idea by picking up Mott's Gooseberry Sessions CD which can usually be found used fairly cheap.
And I was working from the pre-print copy of the Jesus H. Christ album. The actual production run contains "It's OK in the USA" which is pretty great and you should have them send it to you if they haven't already.
Finished up two Dick Destiny tunes over the week in the studio. Guitar-playing is a good way to channel anger. "The Craw," which is an instrumental that I doubt metal fans would have much use for and "Internal Revenue Boogie," which they might if they like heavy stuck in 1972 shuffling white boy blooz. I might post them on my website -- or if I start a blog -- for a couple days.
― George 'the Animal' Steele, Sunday, 23 April 2006 16:42 (nineteen years ago)
― Pangolino 2, Sunday, 23 April 2006 17:10 (nineteen years ago)
― scott seward (scott seward), Sunday, 23 April 2006 17:17 (nineteen years ago)
― Pangolino 2, Sunday, 23 April 2006 18:00 (nineteen years ago)
uh, maybe i was so depressed i wasn't playing very close attention those three times? it's on now, and getting increasingly less playable as it progresses. starts out great, with voivod and the gathering both doing uncharacteristically speedy and poppy songs, and green carnation sound nice and proggy, and soon giant squid sound nice and gothy, but after virgin black (cut #7) it all starts to go to hell. #8 is sleepytime gorilla museum's silly bogus look-how-eclectic-and-weird-we-wish-we-were shtick, and before long thine eyes bleed and sadus (whose new album i'd planned to listen to, though i now assume it will suck) and impaled nazarene and leathora and yyrkoon (who actually are at least more musical than the previous four, for whatever that's worth) are throwing up on the sofa. oh well. (at least i did get through it a few times, more than i can say for *invaders* so far.)
― xhuxk, Sunday, 23 April 2006 19:02 (nineteen years ago)
― blackmail (blackmail.is.my.life), Sunday, 23 April 2006 19:52 (nineteen years ago)
― GOD PUNCH TO HAWKWIND (yournullfame), Sunday, 23 April 2006 20:21 (nineteen years ago)
― don, Sunday, 23 April 2006 20:34 (nineteen years ago)
I think it's pretty good. I still need to hear it a few more times for it to settle in, but I'm liking the band's continued melodic departures. The guitar work keeps reminding me of Voivod's Angel Rat.
― a. begrand (a begrand), Sunday, 23 April 2006 20:40 (nineteen years ago)
― blackmail (blackmail.is.my.life), Sunday, 23 April 2006 22:53 (nineteen years ago)
― pdf (Phil Freeman), Sunday, 23 April 2006 23:01 (nineteen years ago)
Did lots of songs about "ladies" as was the wont back then -- check Pentagrams First Daze Here, for example. Consciously wrote for catchy stuff, even for songs ... like "Stainless Steel Lady," "Pisces Apple Lady," "She's a Striker," "She's Meat." All three albums included. First one s/t has elements of pop psych added to 71 Brit blooz boogie, second -- "Warm Slash" -- was all hard and the highpoint. Third, included herein, was a prog album, never released by the label. TB subsequently going on to a different label and putting out two more basic hard rock records toward the mid-70's, both of which were common fare in the cutout bins.
For fans of Heep's first two, Deep Purple before Ian Gillan, up to but not past "Phenomenon" UFO. If you're not familiar with the '72 sound and are expecting ferocity metal, stay clear or you might hurt your wallet with this one. One of the better retrospecs of a few I've had in the last six or seventh months. Liner notes are interesting and slightly exaggerated. Insinuate band was close to making it. Nope, never happened. First two albums, particularly "Warm Slash" were hardly known in the States. Second, as a Brit band, this act's market was almost solely American by dint of the fact no UK label was much interested in them. I only knew one person who had seen them on a tour undercard in the States and he was an early fan.
Other stuff I saw but passed on. Toad live in Basel in '72. Hey, early Swizz proto-metal featuring Vic Vergat. But I have a Toad solo LP and don't need a live one of him doing Hendrix covers. Plus, it's on Akarma which could mean it was mastered from warped vinyl like my Silver Metre CD, or an old safety tape someone's cat chewed to bits.
The Gods' Genessis which I think Scott mentioned. Early Ken Hensley/Lee Kerslake (?) from U Heep thing. Looked real Brit R&B pop combo muddled up with some Carnaby street psychedelia. File with Plastic Penny, I think. Spooky Tooth's You Broke My Heart So I Busted Yer Jaw which had great ads in Circus and Creem mag, I seem to recall, but which never did anything for me. Luther Grosvenor had left midstream if I recall to join Mott the Hoople. Unfortunately, the album was only mediocre. Mick Jones who still hadn't thought of Foreigner was probably on it. Get the Spooky Two or The Last Puff, both of which are superior.
― George 'the Animal' Steele, Sunday, 23 April 2006 23:06 (nineteen years ago)
― George 'the Animal' Steele, Sunday, 23 April 2006 23:07 (nineteen years ago)
My all-time favorite Tucky Buzzard song. So insanely fucking funky and rockin'. I can't believe nobody has ever sampled it before in the rap/phat beatz world. Or maybe they have, and I just haven't heard it. I put it on all my mix-tapes. It never fails to rouse me from whatever stupor I'm in.
― scott seward (scott seward), Sunday, 23 April 2006 23:13 (nineteen years ago)
I am going to say I like the Tucky Buzzard retrospec a good deal more than the label's similar job on Three Man Army, another band from the same time that morphed into the better known Baker-Gurvitz Army. Baker-Gurvitz Army albums were always in my old college's bookstore. I'm not sure anyone bought records there.
― George 'the Animal' Steele, Sunday, 23 April 2006 23:27 (nineteen years ago)
Crucified Barbara (Swedes not Italians) are way better. Sometimes the vocals lack presence, but "I Need a Cowboy From Hell" and "Rock and Roll Bachelor" and "Hide Em All" (as in hide both your boyfriend *and* your girlfriend they say) totally work, and "I Wet Myself" (about peeing not otherwise getting excited) is a hoot. I even kind of like the ballad, "Losing the Game." Though the Motorhead cover and other songs suffer from singing trying too hard to be "metal" (in a way that reminds of L7 actually -- hey Jeanne, have you heard these goils?) Basically they're better off closer to Mensen than closer to L7, but then who isn't?
Leanne Kingwell kicks their butts like she kicks everybody's this year, though. My favorite cuts, I think: "Look At My Life," "Holding Your Gun," "You Stink," "Drop Your Pants" (what is the famous knife-fight *Nuggets* riff in that one from? I'm thinking "She's a Witch" by the Sonics, but I may be off. And the "You Could Get Happy" in it reminds me of the Easybeats and somebody else), "Can't Get Enough" (where Leanne requests a spanking and biting.) Which is to say the hardest rocking ones, which are also her catchiest ones, which is cool.
George, did you check out the Dirty Birds yet? I talked about them upthread, and though sometimes their vocals get lost in the mix too, most of their album is holding up and then some. Some highlights: "White Lightnin' Shine" ("I wrote a country song/You'll never get the redneck out of me" done as backwoods post-Burdon/Morrison/Fogerty hard-guy hard-rock that occasionally but not too often veers toward Birthday Party/Antiseen shtick, just like much of the album); "Loose Cannon" (huge heavy swinging monster truck boogie, like Savoy Brown or somebody maybe), "12, 10 & 8" (Dr. Feelgood/Bishops pub metal with saxophones), "Paid on Friday" (their most frantic cut, about needing money, reminds me of the Sonics), "Living in the Past" (curmudgeon-themed early Nugent rock with Gerry Rosalie screams, about what happened to the jukebox and the USA, they're still here but they're not the same), "#32" (howling he-man with harmonica choo-choo chug boogie). Spoken part in (I think) "Louisiana Graveyard" reminds me of, uh, Dick Destiny of all people. And the bonus cut is "Good Morning Little Schoolgirl" - is that Muddy or Wolf? I always forget.
― xhuxk, Monday, 24 April 2006 00:07 (nineteen years ago)
Shame on you!
― Brigadier Lethbridge-Pfunkboy (Kerr), Monday, 24 April 2006 00:14 (nineteen years ago)
The more I hear it, the more ordinary the new Lacuna Coil sounds. Starts off strongly, ends strongly (that Depeche Mode cover is killer), but the usual problems arise in between: too repetitive, too much of the guy singer...everyone who listens to the band wants to hear Cristina, and the tone-deaf dude is a pretty useless vocalist, especially on this CD.
And I never thought I'd ever say this, but the recent Lullacry album is definitely better. Much more of a fun 80s pop metal vibe, with hooks taking precedence over goth moping.
― a. begrand (a begrand), Monday, 24 April 2006 00:16 (nineteen years ago)
― d. first, Monday, 24 April 2006 00:30 (nineteen years ago)
And to answer the question, didn't get around to the Dirty Birds. Saw the Cd Baby page, was intrigued, and earmarked it but haven't acted.
Second CD on Tucky Buzzard has second half of Warm Slash wherein they do a song called -- uh -- "Heartbreaker" -- which isn't THE "Heartbreaker" but which sure sounds like it was mixed on the same desk as Led Zeppelin II which is surely accidentally on purpose. Third unreleased album has them go to Spain and hire the Madrid Philharmonic to do a white boy blooz and orchestral prog fest with horns, too. Here they're aping Uriah Heep and Deep Purple and probably about half a dozen others and while it's not as great as Warm Slash, it's still pretty good. You can tell they tried. It's actually way better than Deep Purple with the London Philharmonic or whatever it was.
Why Spain? Because stuff was cheap under Franco and they had a pop hit under the name The End -- a Spanish language cover of Mungo Jerry's "In the Summertime" there. Yugg. It's not on this collection.
― George 'the Animal' Steele, Monday, 24 April 2006 00:46 (nineteen years ago)
― d. first, Monday, 24 April 2006 00:57 (nineteen years ago)
And now xpost --
...if you are wondering why the organ sounds so good on Leanne Kingwell's solo record, it's because the old dude from Procol Harum is playing it.
― George 'the Animal' Steele, Monday, 24 April 2006 01:00 (nineteen years ago)
― d. first, Monday, 24 April 2006 01:17 (nineteen years ago)
― don, Monday, 24 April 2006 02:03 (nineteen years ago)
― George 'the Animal' Steele, Monday, 24 April 2006 02:38 (nineteen years ago)
― d. first, Monday, 24 April 2006 02:47 (nineteen years ago)
― d. first, Monday, 24 April 2006 02:48 (nineteen years ago)
― d. first, Monday, 24 April 2006 02:50 (nineteen years ago)
― don, Monday, 24 April 2006 04:02 (nineteen years ago)
― a. begrand (a begrand), Monday, 24 April 2006 07:37 (nineteen years ago)
Erm, no. Chris Copping played keys and bass for Procol Harum. When he did keys, there was no need for a bass player often as was the practice in clever heavy classic rock bands of the era. When he played bass, Brooker took up the slack. Trower was the guitarist. A very thick-sounding band. Anyway, key in on the bridge of Leanne Kingwell's "Blind" for the full value of Copping's contribution. It takes the emotionality of the tune and puts an exclamation point on the proceedings.
The Leanne Kingwell record is not only a wonder of terse but efficient pop rock and roll songwriting, but also of classic rock guitar tone. There's Tommy Shondell riffage, vibrating tremolo guitar, Troggs stomp and you can hear the Leslie (or the Fender Vibratone) feedback in a whirl of Doppler on one of the best songs. This'll send xhuxk and don scurrying to check it. Hint: Listen for the throb/whirl in codas.
For Tucky Buzzard fans, there's a bonfide Daltrey/Townsend/WHO copon the first album, "My Friend." Popoff cocked up TB in his 70's book but got the general vibe on the albums right. The first three Buzzard albums -- which includes the prog fest which not only eclipses DPurple but also the mighty Heep's Salisbury in paces -- are must haves for hard rock freaks of my ilk. I had forgotten how much I liked this band.
I sort of grok why Bill Wyman thought he could force their stock upward. Portions of Warm Slash even sound like stuff from Cactus' One Way...Or Another. They were imitators but good ones who added their individual flavors. And I'm betting someone in Blue Oyster Cult had the first TB album, 'cuz some of their first three Gawlik-alb stuff cherrypicks/antecedes ideas and tone from the first side of the s/t album.
― George 'the Animal' Steele, Monday, 24 April 2006 10:14 (nineteen years ago)
― d. first, Monday, 24 April 2006 13:11 (nineteen years ago)
― pdf (Phil Freeman), Monday, 24 April 2006 17:07 (nineteen years ago)
Who Crucified Barbara mostly sound like [In "Play Me Hard (The Bachelor's Guitar)," "My Heart is Black," plus some of the good songs I mentioned above) isn't so much Mensen or L7 as, duh, GIRLSCHOOL. (That they cover a Motorhead song should have tipped me off sooner, but I didn't think of it!)
Who Atomic Bitch often sound like (in "Mono to Stereo" and especially the very roxy-rollery "Rockit Video") is NICK GILDER, who sang like a girl in the first place. Also sometimes (e.g., "Shortbus") Sweet. So: glam rock bubblegum. Though their fake punk song "Polly Punkneck" is also lots of fun. (In general, their recording sounds smaller than one might hope, so they don't have quite the attack of say Leanne Kingwell, but I don't mind that much. And George is right about the Precious Metal comparison, too.) (You know who should hear them and Leanne? Metal Mike!)
The Dirty Birds also have cool instumentals called "The Hunt," "The Kill," and "The Feast," possibly in honor of that new book *The Omnivore's Dilemna* but then again maybe not. Also, did I mention that lots of their songs have honking saxophone parts? Well, they do.
― xhuxk, Monday, 24 April 2006 17:59 (nineteen years ago)
New Coffins disc coming soon, fyi.
― blackmail (blackmail.is.my.life), Monday, 24 April 2006 18:19 (nineteen years ago)
― scott seward (scott seward), Monday, 24 April 2006 18:51 (nineteen years ago)
― pdf (Phil Freeman), Monday, 24 April 2006 19:27 (nineteen years ago)
― blackmail (blackmail.is.my.life), Monday, 24 April 2006 20:24 (nineteen years ago)
my ears are on fucking fire
― yours fondly, harshaw. (mrgn), Monday, 24 April 2006 20:39 (nineteen years ago)
Anyone else listening to the Mammatus album? It has a real typical stoner rock sound to it, but for some reason it just hits my spot. To me it's like Dead Meadow's hooks (the singer even sounds a tad like him, but not as whiney) with Comets on Fire's distortion and general trippyness. Four songs, 48 minutes.
― josh in sf (stfu kthx), Monday, 24 April 2006 20:44 (nineteen years ago)
― pdf (Phil Freeman), Monday, 24 April 2006 20:51 (nineteen years ago)
awww shit yeah. fuck a boris.
― GOD PUNCH TO HAWKWIND (yournullfame), Monday, 24 April 2006 22:52 (nineteen years ago)
I've been raving about this album on the rolling psych thread. Along with the new album by The Heads.
― Brigadier Lethbridge-Pfunkboy (Kerr), Monday, 24 April 2006 23:05 (nineteen years ago)
― xhuxk, Monday, 24 April 2006 23:28 (nineteen years ago)
― blackmail (blackmail.is.my.life), Tuesday, 25 April 2006 01:03 (nineteen years ago)
― scott seward (scott seward), Tuesday, 25 April 2006 01:18 (nineteen years ago)
This band half-sucked. Vocals = useless. Riffs = half-useless. Tonal vibe = grainy 70's, almost cool. Last song on CD = excellent anthem but why do you have to wait for the entire shtick to play through to get to it?!?
And I posted this on the Witch thread. I'm now thorougly familiar with Witch. Burn, Witch, burn.
I'll give Witch and Tee Pee great cred for the accurately early 70's cover art. I'd buy it on that alone. A perfect recreation of something that would make your weekend after combing the salls of the Quakertown Q-Mart and washing the fried chipped beef smell out of your clothes and hair. And believe me I know. My car was even crunched in a hit-and-run in the gravel parking lot of the place, I loved it so much. I GOT MINT COPIES OF MY STRAY DOG ARCHIVE THERE!
Befitting the Mt. Rushmores/Freedoms/Hookfoots of the time. (Although nothing on it is as good as Freedom's "Toe Grabber.") Completely OTM. Unfortunately, the music is worse than the Mt. Rushmore's (really hard to accomplish), Hookfoot (a little harder to do) and Freedom (not hard to accomplish unless you aim for the first album where they were still doing Procol Harum/Parliaments/the Herd/60's R&B combo gone psyche stuff ).
If you want something that is the actuality of the theoretical promise of Witch, get the new Tucky Buzzard retrospective, in every self-respecting record store now by courtesy of Ryko distribution. The problem with all the bands that imply they're doing retro is that they never actually do real retro, just a shitty facsimile of it. They get only the bad skin and hair right. Also, you could get Toad's Live in Basel '72 or Billy Thorpe and the Aztecs' Lock Up Your Mothers and at least thirty others which I should probably list but, y'know, I've done it here, there and everywhere awready, ask the dudes on Rolling Metal.
― George 'the Animal' Steele, Tuesday, 25 April 2006 01:30 (nineteen years ago)
― scott seward (scott seward), Tuesday, 25 April 2006 01:36 (nineteen years ago)
So what's missing? As the reissues start rolling out, who's been forgotten?
― blackmail (blackmail.is.my.life), Tuesday, 25 April 2006 01:41 (nineteen years ago)
― don, Tuesday, 25 April 2006 01:46 (nineteen years ago)
From the Durtro news: "The split 10" featuring Current 93 and Om is entitled INERRANT RAYS OF INFALLIBLE SUN (BLACKSHIP SHRINEBUILDER). The track by C93 is titled 'Inerrant Infallible (Black Ships At Nineveh and Edom)' and is just under 9 minutes long, and that by Om 'Rays of the Sun/To the Shrinebuilder', which is 8 minutes long." "The cover photographs have been taken by Andria Degens and Tina Gordon. It will be released early May 2006 on Neurot Records (catalogue number NR 043), around the same time as BLACK SHIPS ATE THE SKY, and will be available in several different coloured vinyl editions throughout the USA and UK/EU."
'Inerrant Infallible' was recorded during the endless BLACK SHIPS ATE THE SKY sessions and is thematically linked with that album. The Om track is absolutely stunning, and was recorded during the recording of their magisterial new album CONFERENCE OF THE BIRDS. Neurot Records are at www.neurotrecordings.com.
― scott seward (scott seward), Tuesday, 25 April 2006 01:53 (nineteen years ago)
there have been cheapo cd reissues, dodgy vinyl reissues, and a dodgy box-set, but i really think that The Damnation Of Adam Blessing deserves the deluxe reissue remaster bonus/extra/etc treatment. as far as i'm concerned, they were one of the great hard rock acts of all time and more people need to hear that stuff. (i am completely biased though. i just dig it to death and have no critical judgement to lay down. some stuff just hits you where you live, you know?)
― scott seward (scott seward), Tuesday, 25 April 2006 01:57 (nineteen years ago)
I have never been a hipster no matter how much I have tried. But that's a very nice thing to say blackmail because you really hit the nail on the head on the dimmer star thing. I'd say much dimmer star but it is my weakness that those are the whats and whoms I love. People come by for dinner, look at the CDs lieing about on top of the stereo cabinet and laugh at the names. And if I occasionally play a song for them, they are polite, but I know they want it taken off and I always do.
Most people don't have the taste for the level of delving. There is no reason to begrudge that. I got it by accident because I've always played that kind of hard rock. My first band was called Newton -- my idea -- with the lead singer's "name," Fig. Which he liked for about six months and then became increasingly mortified by. "Please don't call me Fig," he pleaded. It was a lost cause. It was very Mt. Rushmore/Head Over Heels/Black Pearl. Although we aspired to be a combination of Alice Cooper and Foghat.
And that's why I love the stuff. I feel where it comes from. And there is/was always the potential for such bands to spawn ONE GREAT SONG that will vault them upwards into pop land. Cat Mother & the All Night Newsboys!
But, hmmm, as for who hasn't been done. Stray Dog, definitely, but only the first record of two is remarkable. Important because the guitarist, Snuffy Walden, is now all over popular TV soundtracks and has been ever since the success of "thirtysomething."
Point Blank hasn't been done right. There is a retrospec in stores but it's not of the good stuff, which was from the first s/t album on Arista, and Hard Way. Those are incredible reactionaly right wing heavy boogie biker rock LPs, the first with the pic of a shotgun on the cover, well beyone anything ZZ Top would ever do. They were managed by Bill Ham at the time and appeared to have a midget in the band. Songs about they fought the law and the law won but not before suffering a broken nose, beating your girlfriend/wife, gobbling pills in the meth trade, utterly criminal. I'm surprised Clive went for it. He must not have listened closely. Understandable why Hank Davison Band, a bona fide (Euro) biker outfit, is the only partial Point Blank tribute ever.
You could add Nitzinger. The first album in its entirety, most of the third, Live Better Electrically. A live cut from May Y Sol. Nitzinger was so caveman in his lyrics, particularly on "Jellyroll" which he did onstage in everyone's faces. It is maybe the most misogynistic thing I have in my collection -- well beyond GG Allin and it was paid for by a major label. Hearing it even makes me sweat. I never play it if women are even remotely close.
Bloodrock could use a good 2 CD box. Between their live album and albums one through three there's a very good selection waiting to be cherrypicked. Bloodrock has been forgotten but they were an "almost made it" for awhile. I lived in Pennsy burg of less than 2000 and Bloodrock 3 made it to the variety store, being one of the first legit 'heavy' rock albums in my collection. It was certainly better listening than anything by Iron Butterfly. Bloodrock had no time for psyche anymore. They were dirty Texas boogie road dogs who had to roll. And by today's standards, there was a lot of pop songwriting in them. Great natural-sounding conversational singer.
― George 'the Animal' Steele, Tuesday, 25 April 2006 02:11 (nineteen years ago)
― GOD PUNCH TO HAWKWIND (yournullfame), Tuesday, 25 April 2006 02:12 (nineteen years ago)
http://cdbaby.com/cd/brewed
Brewed By Noon, apparently New Yorkers though I've never noticed them being booked anywhere (maybe I just wasn't looking) -- metal in the sense of the Miles Davis & Sonny Sharrock & Blood Ulmer & Power Tools rekkids in *Stairway to Hell.* Sounds good to me.
― xhuxk, Tuesday, 25 April 2006 02:15 (nineteen years ago)
― scott seward (scott seward), Tuesday, 25 April 2006 02:23 (nineteen years ago)
― don, Tuesday, 25 April 2006 03:59 (nineteen years ago)
Yeah, I got it the same day or something. I never heard of 'em either and the CD looks as appealing as getting a stye, everyone in white Boris Karloff Frankenstein face. So original, I've been afraid to crack it. Maybe it will surprise me. They got the rockabilly image with the guitar player wielding the big Gretsch. Not a bad publicity thing to be denied access to the states on what amounts to a tour of dives. Given the choice I might say, yes Mr Immigration and Customs Man, I am a convicted drunk & disorderly scofflaw and foreigner with a British accent. Purge me!
Juliana Hatfield thing arrived today, too. I'm so sorry I ever went to collidj.
― George 'the Animal' Steele, Tuesday, 25 April 2006 05:30 (nineteen years ago)
― pdf (Phil Freeman), Tuesday, 25 April 2006 11:25 (nineteen years ago)
― xhuxk, Tuesday, 25 April 2006 13:06 (nineteen years ago)
― scott seward (scott seward), Tuesday, 25 April 2006 20:39 (nineteen years ago)
― xhuxk, Tuesday, 25 April 2006 22:02 (nineteen years ago)
― blackmail (blackmail.is.my.life), Wednesday, 26 April 2006 03:05 (nineteen years ago)
― xhuxk, Wednesday, 26 April 2006 10:49 (nineteen years ago)
CHIODOS - Attention-deficit-disorder screamo-core from Michael Moore and Grand Funk Railroad's beloved Flint, capable of pretty proggy piano passages, but more often given to barfy tantrums. Think the Blood Brothers, but perhaps more radio-ready.
CHILDREN OF BODOM -- These blackdeathmetalcore Finns have been grumbling, groaning, and grinding since 1987. Their new *Are You Dead Yet* starts out an industrial-disco note, adds a cover of a Ramones song about being slipped a mickey for Stateside consumption, gets slightly Voivod-melodic when it slows down and progs up, but doesn't do that near enough.
TOM VEK -- He's really not very garage, but this British chap's emaciated keyb ditties sometimes contain nice patches of fuzziness.
THE ORION EXPERIENCE -- First song on their EP sounds like Dandy Warhols with a girl singing plus a fake-British-accent fellow. Second song sounds like a B-52s/Dead Milkmen hybrid stiffly rapping protest whines about Mouseketeer pop stars and the decline of the nation, and it's kind of fun regardless. The rest follows suit, with handclaps. Biracial, recorded in Williamsburg. Totally new wave!
DIG JELLY -- Sticking feisty-cute off-key girl grunts atop mook-metal chugs and turntabled or keyboarded electro-beats, Dig Jelly would seem to sort of be L.A.'s answer to Mindless Self Indulgence except not as wacky; surprisingly, though, they actually turn more fun when sk8ter-grrrl Rayko tries to rap
GREEN MILK FROM THE PLANET ORANGE -- One of 342 Japanese bands to put out noisy drone CDs in the US this year, GMFTPO have a sillier name than most, and also longer, more aimless, and less galvanizing tunes
SILVERSTEIN -- Whine-then-puke-then-whine-some-more screamo from Ontario, with some nimble, even dramatic proggish powerchord moments when singer Shane Told stops baring his tragic soul, which tragically he does not do nearly enough.
GROUP SOUNDS -- "The only unsigned band to appear on the Fuse Network's Daily Download" toes the same dance-oriented '80s haircut-pop line as the Killers, Bravery, Hot Hot Heat, etc., and is hence as necessary as a hole in your head.
THE STALKERS + ELECTRIC SHADOWS + THE TIMEFLYS -- The Stalkers are good-naturedly shambling local party boys who sound like if the Strokes listened to more Faces (or at least more London Quireboys) records. Electric Shadows are locals seemingly aiming for a similar niche, but who need more seasoning and swing to pull it off. The Timeflys are Frisco garage fuzzers whose run-of-the-mill lo-fi recordings display less "Cro-Magnon genius" than *Maximum Rock n' Roll* claims.
MELISMATICS -- "Minneapolis indie-popsters," which means that not only do they sound like the Replacements after the Replacements started to suck (say, 1987 or so), but one guy even looks like Paul Westerberg! Watch out, Goo Goo Dolls!
CAINE -- Niftily noisy instro-metal improvisatory jazz trio, judging from the five songs on the *Pipe* (har har) CD (four of which exceed six minutes, with two over nine. So yeah, they get lost sometimes.) The drummer, impressively, has worked with Tim Berne and Dave Douglas, and guitarist-frontman Adam Caine used to be associated with Bat Eats Plastic, who did really swell Bush Tetras-style stuff.
KITTY KAT DIRT NAP -- Handclappy indie fivesome from Philly, with a powerpop-to-Cars-to-Pixies bounce, a Dead Milkmen-nasal emo boy dueting with a squeaky girly, and silly song titles that mention Van Halen, Phil Collins, Tony Danza, Sparklemotion, Java Scripts, and breath mints. Every one of the nine titles on their amusingly robot-veteranarian-artworked CD has a parentheses in its title.
CODESEVEN -- From Winston-Salem, amorphously unrocking elevator-emo for Talk Talk fans in need of sleep.
SPUNK LADS -- Union-jacking local lads portraying lager-logged Limey street punks with Cockney accents. They have silly names (Bloody Dick, Prince Albert, Nick Knickers, Sir Jack Hammersmith); they prefer ska-and-polka-and-jig beats and New York sidewalks to fascists; and they make "While My Guitar Gently Weeps" less gentle. THE OPERATORS -- Not to be confused with quirky Boston girl-rock trio of the same name, these Operators are trash-organed, ska-lilting, jolly-sounding gang-punk hockey pucks from the frozen tundras of Edmonton, Alberta.
AMERICA IS WAITING + FORM OF ROCKET -- America is Waiting are a jagged, melodramatic, high-registered and high-strung clatter-rock band of the sort that's often called Austin home since Scratch Acid two decades ago. Salt Lake City's Form of Rocket go for just as much clamor, similarly Yow-like yowls, and more math equations.
PINK GREASE -- Like Franz Ferdinand, these Add N to (X)-boosted Sheffield kids have fairly goofy energy for Brit-poppers. But that's not saying much, and Placebo (for one) has been rocking both harder and swishier for ages. Nitwits compare 'em to the Stooges or Suicide; really, they're closer to Spacehog, or Blur's glam side, with a vocalist occasionally trying out James Chance affectations, and words allegedly about Aaliyah and Lou Reed.
SCARLET -- Math-corps screech-tantrum-metal denseness-bordering-on-ambience of the Zao/Dillinger Escape Plan/Meshuggah stripe. I.e., nothing Void and Die Kreuzen hadn't beaten into the ground by 1986. But not awful.
MINIBOSSES -- Indie abstract algebra students from U Mass playing intricately wanky metal solos (not ironically at all, yeah right) with no songs attached: same genre as Fucking Champs or Oxes. Except the compositions are said to actually be themes from video games, apparently with names like "Castlevania 3" and "Mega Man 2."
COHEED AND CAMBRIA -- Never mind these upstate prog kids' alleged emo pedigree. Rumors that the quacking falsetto histrionics and impossible time-change melodrama and beautiful sci-fi hogwash and three-parts-in-14-minutes epics on last year's *In Keeping of Silent Earth: 3* recall Rush are, if anything, understatements. Not only do they sound more like Rush than Mars Volta, they sound more like Rush than Rush *themselves* have for two decades. So they shatter the illusion of integrity for sure.
TAPPING THE VEIN -- A missing link between the already forgotten Drain S.T.H. and Evanescence who've yet to hit even as big as the former, these Philadelphians have never quite been beautiful, danceable, goofy, or German enough to pull off their black-clad Siouxsie-lookalike-led post-industrial power-ballad goth-shlock, though their 2002 album *The Damage* does at least start to soar at points. Tonight they headline an "electro-rock festival."
SEWER DOVES -- Melodic glam-rumbled Brooklyn guitar-squall pop, with uneventful but not unenergetic vocals. They shout "hey now" like Bowie, and sound like 1980 hard rock kids dressed up punk when they're fast and like 1994 hair-metal kids dressed up grunge when they're slow. Their EP's best cut? Either the party tune about emotional distress or the guitar solo.
LONESOME BOB--Quite a buzz in alt-c&w circles for this balding bearded Jersey baritone, maybe because his CD's full of titles like ``He's Sober Now'' and ``I Get Smarter Every Drink'' and ``2 Drinks on an Empty Stomach.'' He mostly sings like a overboozed bull in a china shop, natch. But he can slip a pinch of David Allen Coe into his twang, and ``Heather's All Bummed Out,'' about a 35-year-old looking for love on all the wrong websites while her clock ticks away in her Harrison-Forddd-postered cubicle, deserves a Christgau choice cut at very least.
STIFFED + CHERRYWINE -- People fall for marginal Philly punks Stiffed 'cuz there's an assertive black woman leading; how Santi White (an ex-Res associate) mixes up Bad Brains nasals with Polly Harvey does sound sorta new, too--even with old Goat Chuck Treece's traps limited to stiff-hipped pogos. Seattle Digable Planets spinoff Cherrywine play hippie hip-hop on real instruments, better when seemingly aiming for an early acid-house ambience than when they're mere fake-jazz gangsta-hatas
DIFFUSER -- These so-what Long Island pop-punks have a singer named Tomas Costanza, but he is apparently unrelated to George.
― xhuxk, Wednesday, 26 April 2006 11:13 (nineteen years ago)
― pdf (Phil Freeman), Wednesday, 26 April 2006 20:09 (nineteen years ago)
― don, Wednesday, 26 April 2006 20:42 (nineteen years ago)
Yeah, I'd not want to miss it. I noticed Bogert & Appice had been using Pat Travers in the guitar slot for the past year or so. (or was it Travers using Cactus rhythm?!) It seemed only logical to get Jim McCarty back in if his health is good. You'll probably get an earful of the Ampeg Scrambler and Bogert/Appice's never duplicated lightning shuffle boogie.
― George 'the Animal' Steele, Wednesday, 26 April 2006 21:13 (nineteen years ago)
― Brian O'Neill (NYCNative), Thursday, 27 April 2006 06:09 (nineteen years ago)
― Ned Raggett (Ned), Friday, 28 April 2006 01:52 (nineteen years ago)
― Siegbran (eofor), Friday, 28 April 2006 08:38 (nineteen years ago)
I like that Kampfar album okay. Doesn't exactly blow me away though.
― scott seward (scott seward), Friday, 28 April 2006 09:30 (nineteen years ago)
― blackmail (blackmail.is.my.life), Friday, 28 April 2006 13:45 (nineteen years ago)
yeah, that's about right. probably not a keeper, but more listenable than i'd have guessed. (in other words, at first i didn't think i'd like it at all. doubt i'll return to it much though.)
>Heya Chuck, I'm curious -- why the switch back to capitalization?<
i don't understand the question! was i ever actually consistently one way or the other? (not on this thread -- i seem to keep going back and forth. and not consciously, either way... probably depends more on my mood than anything else. though i have no idea *how*.)
best cuts on the focus odds-and-sods album i bought (*ship of memories*) are "glider," "can't believe my eyes," and "out of vesuvius," which are also (1) the only cuts to exceed five minutes in length and (2) the heaviest-guitared cuts on the thing. not sure how they align with the other cuts chronologically; kinda too lazy to read the long liner notes right now. i'd group them with *red*/*starless and bible black* king crimson; am i way off?
― xhuxk, Saturday, 29 April 2006 15:36 (nineteen years ago)
― xhuxk, Saturday, 29 April 2006 15:45 (nineteen years ago)
― scott seward (scott seward), Saturday, 29 April 2006 15:55 (nineteen years ago)
i'd group them with *red*/*starless and bible black* king crimson; am i way off?
Guitarist Akkerman has some blues in him. Fripp generally doesn't. And Tisj van Leer tends write pop tunes every now and then.
― George 'the Animal' Steele, Saturday, 29 April 2006 16:46 (nineteen years ago)
But yeah, I can see why some above got bored at times. It does meander.
― Brian O'Neill (NYCNative), Monday, 1 May 2006 07:12 (nineteen years ago)
― Raw Patrick (Raw Patrick), Monday, 1 May 2006 12:40 (nineteen years ago)
― scott seward (scott seward), Monday, 1 May 2006 13:13 (nineteen years ago)
― scott seward (scott seward), Monday, 1 May 2006 13:23 (nineteen years ago)
― xhuxk, Monday, 1 May 2006 19:38 (nineteen years ago)
only NEW hard rock/metal album i've played much in the past few days is *rebel meets rebel* by d.a.c. (as in david allan coe) and c.f.h. (as in cowboys from hell, which means dimebag darrell who is dead plus vinnie paul who is i think his brother on drums and rex brown who may or may not be in pantera--how the hell would i know?--on bass). at first i thought, "uh, nice try, coe can't sing anymore, but at least he sings better than phil anselmo", but then i decided it doesn't really matter; coe *doesn't* have the voice he used to have, the point's moot in this kind of biker rock (heaviest and/or funkiest and most successfully boogiefied in "heart worn highway" which is actually kinda jazzy in a '70s hard rock way; "cowboys do more dope" with its shouted anthem chorus about how country rocks harder than rock these days and also takes more drugs; "cherokee city" about how people fucked over the native americans; "time" which is a great hendrix rip with "ball of confusion"-meets-hombres rhyme-rapping and roky erikson-style observations about "alien forces inside my brain"); i also really like "arizona rivers" (fluttery psych-blues not far from j.d. blackfoot's CD last year) and "nyc blues" (understated talk-vocal walk through the east village a la peter laughner or whoever about seeing weirdos with blue hair, namedropping cowboy junkies probably because d.a.c. likes their name then talks about prince and purple rain and ends the album afterwards with a snippet of an apparently shitty song called "proud to be an american" by some band called pumpjack, played over the car radio which doesn't make sense because it's not a song about driving, but this is still like when rappers end their album with part of a new rap song by their unknown rapper pal who has an album coming out next year, so it's a neat idea. also: "nothin to lose" has female sex moans in it; "rebel meets rebel" is more heavy biker funk; "one night stand" is more heavy rock'n'roll with a "day tripper" riff and a verse that says one night stands aren't just for sleeping with women but also for bands (presumably like this one-off here); "get outta my life" isn't horrible but hank williams III's dumbass fred durst imitation in it is (what do people see in that dork again?); "no compromise" has more talked verses. in fact, in general, coe talks as much as he sings, which is a good idea. so: way better than any pantera album; also way better than the EP that coe made with kid rock a couple years ago (which i got sent a CD-R advance of; don't think it ever came out.)
― xhuxk, Monday, 1 May 2006 20:08 (nineteen years ago)
― xhuxk, Monday, 1 May 2006 20:39 (nineteen years ago)
― xhuxk, Monday, 1 May 2006 20:46 (nineteen years ago)
― xhuxk, Tuesday, 2 May 2006 20:55 (nineteen years ago)
http://www.youtube.com/watch?v=58UAtXfRlVM&search=heavy%20metal%20kids
http://www.youtube.com/watch?v=y90O9YchAIA&search=heavy%20metal%20kids
http://www.youtube.com/watch?v=vMLKLkYLdx0&search=heavy%20metal%20kids
― scott seward (scott seward), Wednesday, 3 May 2006 02:53 (nineteen years ago)
And speaking of not really having tunes, I kinda like the sound (Robert Plant via early Bowie/Jack White in Zep post-Donovan travelogue folk bombast mode, mostly) on this local EP *Radio* by a guy who calls his band Angiescreams on his myspace page (yeah, I've progressed/ regressed from cdbaby obsession to myspace obsession - not gonna get a page myself though, I promise) though his name is apparently Arthur Lynn and he sure wears open shirts with no undershirts a lot (golden god poses, no hair on chest), but the guy just plain lacks memorable actual songs near as I can tell. "Baxter" is more country with sax parts, and "Magazines" and "Show Me" etc. have a decent sense of drama and a healthy wash of sound that picks up and kicks, but no grabbable hooks to make them sink in, somehow.
By now, though, I'm not even sure who I'm telling all this to...
― xhuxk, Thursday, 4 May 2006 12:17 (nineteen years ago)
― scott seward (scott seward), Thursday, 4 May 2006 12:29 (nineteen years ago)
― Thomas Tallis (Tommy), Thursday, 4 May 2006 12:31 (nineteen years ago)
i like the new skinless album on relapse. chuck, you would love it! not!
― scott seward (scott seward), Thursday, 4 May 2006 12:33 (nineteen years ago)
i wrote a youtube metal thing for decibel last weekend. i would like to thank everyone who posted cool vids on the youtube metal thread cuz those clips were what i wrote about for the most part. your check is in the mail.
― scott seward (scott seward), Thursday, 4 May 2006 12:35 (nineteen years ago)
i dunno...eventually, probably. it always takes me a while to get around to watching stuff like that. (i don't turn on my tv much, either.) just got a new laptop though (i'm on it!), so who knows..
also, maybe this just makes me a schoolteacher but who cares; i just get really frustrated with these rolling threads and have trouble seeing their usefulness when they devolve into *only* people posting links and saying "i like this new record i just got" but *never* saying why, so it might as well all be the same record. it's why i stopped posting on the pysch/drone thread a while ago, too...
― xhuxk, Thursday, 4 May 2006 12:53 (nineteen years ago)
― scott seward (scott seward), Thursday, 4 May 2006 13:05 (nineteen years ago)
― xhuxk, Thursday, 4 May 2006 13:10 (nineteen years ago)
anyway, the new skinless album is a goregrind album and it sounds not unlike other goregrind albums. the theme is war, total war, where victory's a massacre, the final swing is not a drill, it's how many people you can kill.
there, how's that?
― scott seward (scott seward), Thursday, 4 May 2006 13:14 (nineteen years ago)
Had a long talk with a couple of producer/mastering guys yesterday and enjoyed hearing them talking mainly to each other (I'm a total novice/moron) about what's wrong with mastering these days, and why your ears get fatigued so quickly listening to some stuff but not other, louder stuff. Their take was "the louder the source, the more you should ramp it down in mix & if people wanna hear it loud, they can turn it up" - otherwise all the available space gets used & the ear can't really comprehend what's going on any more, and the listener then quickly maxees out his attention span. This is an ancient discussion, old as the CD at least, but was interesting to me.
― Thomas Tallis (Tommy), Thursday, 4 May 2006 13:19 (nineteen years ago)
The new Skinless album has my vote for album title of the year so far: Trample The Weak, Hurdle The Dead. I don't like their music as much as, say, Exhumed, but they're okay. And I'm surprised to see Misery Index is on Relapse now - their last one was on Nuclear Blast, I think. They're okay semi-chromed thrash; if you like the second Chimaira album, you'll like them.
― pdf (Phil Freeman), Thursday, 4 May 2006 14:41 (nineteen years ago)
kampfar back in the CD changer this morning, up against the new Streets CD (which is growing on me, more for its often admittedly amusing stories than for mike skinner's increasingly dull rapping and increasingly duller beats), two really good cdbaby country CDs by the True Brothers, and (most relevantly here) falkenbach's cool combo of pagan chants and soaring hawkwind pysch and melodic death drone and "childen of the grave" grooving (which is, at best, my third or maybe fourth fave napalm CD this year, behind korpiklaani and tyr and possibly summoning), and kampfar confirm once and for all that they just don't stack up. i want them to, but they don't.
― xhuxk, Thursday, 4 May 2006 15:51 (nineteen years ago)
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Thursday, 4 May 2006 16:07 (nineteen years ago)
― scott seward (scott seward), Thursday, 4 May 2006 16:36 (nineteen years ago)
― pdf (Phil Freeman), Thursday, 4 May 2006 17:25 (nineteen years ago)
― Thomas Tallis (Tommy), Thursday, 4 May 2006 17:31 (nineteen years ago)
scott, i agree the streets album is by far his most boring -- he *sounds* bored. but then again, maybe that's part of the point, that fame is boring, especially if (as you say) one is only a little bit famous. (i mean, i do think he the fact that he's not all that famous is part of the intended humor -- hence, when he hits on a famous girl, he says he gets treated as if he's still *not* famous by her.) (also, he has nothing to do with metal, obviously, except in the sense that working class british guys who can't sing becoming famous and wrecking hotel rooms has to do with metal, at least.)
― xhuxk, Thursday, 4 May 2006 17:54 (nineteen years ago)
When I was a kid, Channel 5 here in NY/NJ (I lived on Staten Island back then) used to run them in the afternoons at 3 or 4 o'clock, so kids could watch them after school. The second one, Beneath The Planet Of The Apes, was scary as hell when I was about six or seven, and yet it was rated G when it originally played theaters! I think they all were, in fact...
The whole series is available in two different boxed sets. One has all five movies, plus the complete run of the (unspeakably shitty) live-action TV series, plus the (also unspeakably shitty) Tim Burton/Marky Mark remake, and comes in a plastic ape head. The other has just the original five movies, and comes in a box.
― pdf (Phil Freeman), Thursday, 4 May 2006 18:06 (nineteen years ago)
― pdf (Phil Freeman), Thursday, 4 May 2006 18:32 (nineteen years ago)
Hey, I'm around too, I mostly just read. Also I've been getting my aggro kicks this week from the new Tool, which presumably revolts many of you. ;-)
― Ned Raggett (Ned), Thursday, 4 May 2006 18:34 (nineteen years ago)
it was awesome
― Thomas Tallis (Tommy), Thursday, 4 May 2006 19:02 (nineteen years ago)
― pdf (Phil Freeman), Thursday, 4 May 2006 19:24 (nineteen years ago)
― xhuxk, Friday, 5 May 2006 12:37 (nineteen years ago)
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Tuesday, 9 May 2006 20:55 (nineteen years ago)
― GOD PUNCH TO HAWKWIND (yournullfame), Tuesday, 9 May 2006 23:17 (nineteen years ago)
http://www.dickdestiny.com/blog/dickdestiny.html
― George 'the Animal' Steele, Thursday, 11 May 2006 22:57 (nineteen years ago)
― GOD PUNCH TO HAWKWIND (yournullfame), Thursday, 11 May 2006 23:24 (nineteen years ago)
― Ian Christe (Ian Christe), Friday, 12 May 2006 02:35 (nineteen years ago)
― Herpes Insultor, Friday, 12 May 2006 03:03 (nineteen years ago)
― The Poper Toper Interloper, Friday, 12 May 2006 03:09 (nineteen years ago)
the pre-sextrash band?
― GOD PUNCH TO HAWKWIND (yournullfame), Friday, 12 May 2006 05:42 (nineteen years ago)
― The Poper Toper Interloper, Friday, 12 May 2006 07:15 (nineteen years ago)
Black Church
The fate revenger what was written,Plumed spirits up to the earthAnd by all of the churchs dispersingEntering on the bodies priestsMaking the jesus christ believesCome to be Satan's slave...
The hell buches dispersing the orgy byThe earthAnd the black bible was discovered,The slaves of antichrist revengesOf the jesus christ slavesAnd the blood drip again...
Black Church...
(Lyric by Pussy Ripper - Music by Damned Sentry "Insulter - 1986")
― Ian Christe (Ian Christe), Friday, 12 May 2006 07:41 (nineteen years ago)
― pdf (Phil Freeman), Friday, 12 May 2006 13:49 (nineteen years ago)
― blackmail (blackmail.is.my.life), Friday, 12 May 2006 14:02 (nineteen years ago)
― pdf (Phil Freeman), Friday, 12 May 2006 14:05 (nineteen years ago)
― pdf (Phil Freeman), Friday, 12 May 2006 14:06 (nineteen years ago)
http://www.geocities.com/occult_library/coven4.jpg
― Ian Christe (Ian Christe), Friday, 12 May 2006 18:33 (nineteen years ago)
― scott seward (scott seward), Friday, 12 May 2006 18:38 (nineteen years ago)
― George 'the Animal' Steele, Friday, 12 May 2006 18:44 (nineteen years ago)
I was at the Roadrunner office today, listening to the new Stone Sour album. I liked the first one, and the new one is better; Roy Mayorga's been brought in on drums, and he really churns things up. There's a token ballad, coming soon to a crap radio station near you, and a fast 'n' heavy song that's gonna be force-fed to MTV sometime soon (Hatebreed have just signed with Roadrunner, and their singer hosts Headbangers' Ball, so synergy ahoy!). While there I loaded up on discs, grabbing the deluxe CD/DVD reissues of Mercyful Fate's Melissa and King Diamond's Abigail, the CD/DVD version of Trivium's Ascendancy (which features their crushing version of "Master Of Puppets" as a bonus track), and the most recent discs from Opeth, Chimaira and Devildriver. They also handed me the new Dresden Dolls and New York Dolls things, but I don't care about either of those.
― pdf (Phil Freeman), Friday, 12 May 2006 19:30 (nineteen years ago)
― scott seward (scott seward), Friday, 12 May 2006 19:38 (nineteen years ago)
― pdf (Phil Freeman), Friday, 12 May 2006 19:44 (nineteen years ago)
― pdf (Phil Freeman), Friday, 12 May 2006 19:45 (nineteen years ago)
― Je4nn3 Æ’urÂ¥ (Je4nne Fury), Friday, 12 May 2006 19:53 (nineteen years ago)
― scott seward (scott seward), Friday, 12 May 2006 20:20 (nineteen years ago)
wha? where? i've been looking.
― GOD PUNCH TO HAWKWIND (yournullfame), Friday, 12 May 2006 21:33 (nineteen years ago)
― scott seward (scott seward), Friday, 12 May 2006 21:50 (nineteen years ago)
― scott seward (scott seward), Friday, 12 May 2006 21:51 (nineteen years ago)
http://www.amazon.com/gp/product/B000E1NV56/qid=1147474343/sr=2-1/ref=pd_bbs_b_2_1/102-4572471-9551313?s=music&v=glance&n=5174
― scott seward (scott seward), Friday, 12 May 2006 21:53 (nineteen years ago)
http://myspace.com/mattoree
― xhuxk, Friday, 12 May 2006 22:26 (nineteen years ago)
Just got done with Savage Grace's 2 LP. Not sure quite what the fuss is about this group - I've only spun it once and found that not much of it has stuck to my ribs (so to speak). For the duration of the first side, its as though they desperately want to unleash some kind of Foghatty (well, proto-FH, I guess, since this is from waay back in '71) Southern rock racket, but every time things start to crescendo, they let their keyboard guy take over and stop everything dead with some REALLY dull ivory tickling (more like Styx or something (or, er, what Styx would sound like later that decade) rather than the cool honky-tonk piano stuff you hear on, say, Skynyrd LPs). Aside from that, its not really BAD, I guess, and things kinda pick up a bit on the second side. Side-opener "She's a Woman" is actually KILLER. Great throbbing auto-mechanic rock, like they heard the "call me the hunter" part of that one Zeppelin tune and decided to make a whole song out of it. The very next song is "Macon, Georgia," which sounds exactly like "The Weight." This whole LP is pretty much like an occaisionally heavier Band album. The last song, "Lady of the Mountain", sounds to me like some kind of hard rock version of Richard & Linda Thompson's "Walking on a Wire", surely a worthy accomplishment.
― Handsome Dan, Friday, 12 May 2006 23:52 (nineteen years ago)
― pdf (Phil Freeman), Friday, 12 May 2006 23:56 (nineteen years ago)
New Skinless is a death metal record. Unsurprising but solid.
― Brian O'Neill (NYCNative), Saturday, 13 May 2006 11:16 (nineteen years ago)
gaaaah damn you they want like eighteen bucks for these things in stores!
― Thomas Tallis (Tommy), Saturday, 13 May 2006 12:55 (nineteen years ago)
Q: You used to appear on stage with a human skeleton named Melissa, which was stolen after a performance - did you ever figure out the final fate of Melissa?
A: Nope. That skull was very unique. It was obviously a skull that had been through a medical institute, because the top had been sawed off. If you looked at the top of the skull, you could see that the person had received a major blow to their upper forehead. There was a piece of the skull – maybe the size of a quarter or so – was loose. On the outside, it looked big. But it was a very small hole on the inside. Part of that had been knocked loose and reattached to the skull. That was all the way back in the same time period, 1981 or 1982. I always wondered what that person’s life was like: what caused that blow to the skull? What was this person’s life like? For some reason, I had to name it “Melissa.” I’m not sure why. That’s where the song “Melissa” came from. For all intents and purposes, she could’ve been a witch burned at the stake. But that wouldn’t be my real guess – it’s just what came through my fantasies and imagination.
― ng-unit (ng-unit), Saturday, 13 May 2006 13:03 (nineteen years ago)
― Handsome Dan, Saturday, 13 May 2006 19:48 (nineteen years ago)
― xeddy, Saturday, 13 May 2006 20:02 (nineteen years ago)
― scott seward (scott seward), Saturday, 13 May 2006 20:20 (nineteen years ago)
― xhuxk, Saturday, 13 May 2006 20:39 (nineteen years ago)
― scott seward (scott seward), Saturday, 13 May 2006 20:55 (nineteen years ago)
The 1994 reissue came today. It's on Rock Candy, is pushed by a couple Brit metal critics, was never in CD land previous. Jack Douglas-produced band that was formerly the LA Jets with Karen Lawrence. The LP took off on the second side into amazing woman blooz singer fronting band doing stoked Aerosmith and Led Zeppelin-styled heavy rock. The closer, "Anastasia," is volcanic even down to the imitation balalaika [on second thought, it's probably the real thing]. Another prime cut is "Radio Zone." Lawrence wrote a song made into a hit by Barbra Streisand, but couldn't collect on it because as a youthful member of the LA Jets, had signed away her publishing in exchange for a record deal.
She also sang backup for Aerosmith and is now in a reasonably well known blooz band in California. Comes with some extra live cuts -- raw and fuzzy from cassette, showing she could sound incredible, like an air raid siren on some tunes.=======
Steve Hunter was in the band for awhile. I recall not liking the second except for the title cut. First cut on the debut has the great lyric about Karen being down on her knees once again, being fucked by the record company. Which they were. CD came with better packaging photo than the original vinyl, Lawrence in provocative leather. The band was more or less nonexistent on the cover until the second LP. Why? Were they taking stupid pills?
I might put it up on the Dick Destiny blog. Although I seem to have said everything I have to. Was thrilled to have it once again. Second warning, the live cuts are atrocious except for theair raid vocal on one tune.
― George 'the Animal' Steele, Saturday, 13 May 2006 21:42 (nineteen years ago)
― Handsome Dan, Monday, 15 May 2006 21:23 (nineteen years ago)
>none of these LPs sold very well, did they <
Well, Loverboy sold; their first couple LPs (especially the first one) had plenty of new wave sounds on them, though maybe not as much as the band they evolved out of, Streetheart. And Pat Benatar sold, obviously. And Prism (more new wave than Saga or Aldo Nova) had a couple hits. And Cheap Trick, if they count. (Do kids now understand that, in 1978, at least in Detroit, they were considered new wave?) But they were kind of earlier, as were the Tubes, though new wave maybe made Tubes *more* new wave went they weren't going more Doobie Brothers. But basically, I think you're right, Dan - The Hounds didn't sell, and neither did the Reds, or the Kings (though they had a bit of AOR airplay), or SVT, or Pearl Harbor & the Explosions, or Shakin Street. Who else? Sniff N the Tears had a hit; do they count?
― xhuxk, Monday, 15 May 2006 21:45 (nineteen years ago)
"the Cars may share a producer with Queen, but they share a&r, not to mention key musical ideas, with Television and the Dictators"
"Because it's the nature of complacent cowards to hedge all bets--and because they want to prove they're not, you know, square--they reassert their own putative attachment to 'good' rock and roll at the same time, thus easing the sales breakthrough of 'twixt-wave-and-stream bands like the Cars and Cheap Trick. A similar snap-to by old fans (including radio people) who had previously been backsliding into resignation makes quick, surprising commercial successes of Dire Straits (42nd in Pazz & Jop despite late-year release) and George Thorogood and the Destroyers (51st despite a small press list), spearheading a minor white-r&b revival."
― xhuxk, Monday, 15 May 2006 22:20 (nineteen years ago)
Rick Springfield was definitely marketed with a new wavey look when I saw him on Dave Clark. He sold. Sammy Hagar had an odd in-between image, with short hair and goofy red clothes -- which he has kept but they're no longer quite as silly looking, when he was on Capitol. The albums were poppy hard rock, more pleasant than his later stuff, and would have def appealed to the new wave audience. Hagar was not a big hit but he sold well enough to keep him in business.
The Cretones were another, more famous for backing Linda Ronstadt on one album that was her "new wave" LP. Face Dancer -- didn't sell. Yipes -- didn't sell. Susan -- put Ricky Byrd, a killer hard rock guitarist, into the the Blackhearts, and didn't sell. Made one pretty good album that hasn't been reissued.
Sunset Bombers were a hard rock band that put one of their guitarists into 1994. He's on the second as a full-fledged member. SBombers would have done better being more metal. As it was, they sounded half-assed and nothing. Silver Condor were a hard rock band that went New Wave and paid for it. Maybe they would have paid for it anyway. Derringer even went New Wave, at which point Pat Benatar stole his backing band. Saunders swears by "If I Weren't So Romantic, I'd Shoot You" but when Danny Johnson and Vinnie Appice left and were replaced by Myron Grombacher and Garaldo, they went to shit on LP with a New Wave pop sound. It didn't help them but worked wonders for Pat Benatar. For the Derringer/Benatar band record, there was a genuinely horrendous version of "Werewolves of London."
Budgie even got weird around that time. The decline started around "If I Were Britannia..." which had some moments. Then the guitarist left, another was found, and they were 'rediscovered' by the NWOBHM, but most of that material stiffed even for Budgie's low expectations and low overhead.
Tubes didn't sell at all, even with the extravagant reputation as a live act. Started to sell when they calmed down the image on record and had a semi-hit (or was it a hit?) with "Talk to Ya Later." J. Geils went sort of New Wave and started having "hits." Their first live album is ferocious r&B hard rock which they slowly kept watering down. Finally it was watered down enough.
― George 'the Animal' Steele, Monday, 15 May 2006 22:29 (nineteen years ago)
― George 'the Animal' Steele, Monday, 15 May 2006 22:39 (nineteen years ago)
― xhuxk, Monday, 15 May 2006 22:45 (nineteen years ago)
― Ned Raggett (Ned), Monday, 15 May 2006 22:58 (nineteen years ago)
― Handsome Dan, Monday, 15 May 2006 23:28 (nineteen years ago)
Oops, remembered another biggie we forgot: The Romantics. Radio stars for a couple years in Detroit, and big enough elsewhere to spawn two big hits, though I'm thinking "What I Like About You" may have only become huge in retrospect, at wedding receptions and sports events. Though their best and punkest album didn't sell zilch.
(Ha ha, we are totally off the subject of "rolling metal" by now, I guess. What the fuck, it's not like anybody was saying much anything interesting about metal here in recent weeks and/or months anyway.)
― xhuxk, Monday, 15 May 2006 23:49 (nineteen years ago)
There.
Xpost
Pentagram cover the Stones, too. "We gotta get more commercial, guys..."
You haven't even begun to cover the heavy rockers who lost their nerve and adopted New Wave or related lite forms, sacrificing what was left of their diminishing fanbase. Foghat? "Zig Zag Walk"? Ted Nugent "Little Miss Dangerous" Judas Priest "Turbo" None of which are necessarily constrained to 78-80.
You forget some of this is systemically driven by pressure to get a "single" in line with whatever the pop lite flavor of the particular year is. And it's not at all necessarily driven by things like bar-types or arena slobs being "revitalized" by something like New Wave. It's an attempt at survival at the end of a contract-terminating gun, which more often than not, fired anyway.
Another example: Ronnie Montrose's Gamma. Have all three albums. They get progessively more synthy, New Wave in a Gary Numan-esque way, until the guitar almost disappears for the third and last one. And this is Ronnie Montrose's band!! Actually, they are all fairly good records, each of the trio for different reasons, and I recommend them, but they show a standard trajectory that has the head man wrestling with commerciality and art and mostly going in the direction of a yearly trend while trying to preserve art.
I may have also read somewhere on rationalization for Budgie's awful last album. They had written a song about Reagan and the Cold War and Russia (I even have it) and tried to make it sort of like Boston and cluelessly thought people would be rushing to hear it. They bummed their remaining fans. It was horrifying. I keep the album because it's so bad.
― George 'the Animal' Steele, Tuesday, 16 May 2006 03:22 (nineteen years ago)
Alice Cooper was good at that, or at least fair, and cheap. He was a chameleon. Some people aren't.
Motorhead. "Orgasmatron" Unlistenable. Became momentarily convinced they should work with someone thought hip and edgy. To revitalize themselves when they didn't need it. Survived the encounter through gumption and tenacity. Luckier than many.
― George 'the Animal' Steele, Tuesday, 16 May 2006 03:46 (nineteen years ago)
― GOD PUNCH TO HAWKWIND (yournullfame), Tuesday, 16 May 2006 03:50 (nineteen years ago)
― George 'the Animal' Steele, Tuesday, 16 May 2006 04:00 (nineteen years ago)
Oh come on, that's a great album! I actually like the production...it's such an odd combination, the mix is so weird. It was a cool departure for a band who had gotten too predictable by the mid-80s. The title track's one of the best things they've ever done....Laswell hit paydirt on that one.
Gotta say, though, the two-CD version of Another Perfect Day is the best of all the recent Motorhead reissues. Not only do you get one of the most underrated 80s metal albums of all time, but there's also a killer live set from the Robbo days. Strange, strange setlist, too, with no "classics" performed (at Robbo's behest, the dink), in favour of Iron Fist/APD material and an inexplicable run-through of "Hoochie Coochie Man".
― a. begrand (a begrand), Tuesday, 16 May 2006 04:44 (nineteen years ago)
― George 'the Animal' Steele, Tuesday, 16 May 2006 04:56 (nineteen years ago)
OTMFM!
you know, one of motorhead's guitarists says he has tapes of a properly-mixed version of orgasmatron. i'd kill to hear that.
― GOD PUNCH TO HAWKWIND (yournullfame), Tuesday, 16 May 2006 05:05 (nineteen years ago)
― rizzx, Tuesday, 16 May 2006 07:51 (nineteen years ago)
― xhuxk, Tuesday, 16 May 2006 10:42 (nineteen years ago)
― scott seward (scott seward), Tuesday, 16 May 2006 11:06 (nineteen years ago)
Ha, in other news, I finally got a copy of the Pearls & Brass CD in the mail yesterday, several months late. The song playing right now, "Black Rock Man," does not seem to have much of a tune to it, and also does not seem to rock very hard. The rest? I'll see. (Okay, "The Boy of the Willow Tree" now -- they seem to be attempting a kind of massed Uriah Heep moan chorus at the start, but aren't pulling it off. Their music's sounding kind of THIN to me, though so far I'm inclined to blame a lousy production job, maybe?)
― xhuxk, Tuesday, 16 May 2006 11:26 (nineteen years ago)
― Brian O'Neill (NYCNative), Tuesday, 16 May 2006 12:03 (nineteen years ago)
As I was listening to Wolfmother one night, Rhino Bucket's & Then It Got Ugly crept into the playlist. In a couple days, I was playing it more. I gave it a chance and its humorless but precise and tight approach to Bon's AC/DC is a superlative work of honest craftsmanship. Everything is rock and roll with the help of a Ruddian drummer who never lets up and "Blood, Sweat and Beers" is the obvious place for people to drop in although it's not the best tune on the album. More later today, I'll send you the update.
― George 'the Animal' Steele, Tuesday, 16 May 2006 12:47 (nineteen years ago)
Okay, no hate. I will only say that, um, the songs where it sounds like they're trying to sound like Jimi Hendrix don't sound any *worse* than the songs where Lenny Kravitz sounds like he's trying to sound like Jimi Hendrix. Beyond, that, I'm having trouble figuring out what's supposed to be so distinctive about them. They sound okay, I suppose. But no more okay than your average stoner band. And a lot less heavy and strange than I'd been led to believe.
― xhuxk, Tuesday, 16 May 2006 15:58 (nineteen years ago)
I'm really mixed about the new Celtic Frost. I really dislike the second song, but the sounds the band has on it are good. I had always wondered what it would sound like if either Peter Tantgren or Dan Swano was to record a Celtic Frost album.
I'm mixed on the pearls & Brass album. I liked it initially but then it fell from grace. I'm warming up to it again, but I definitely prefer their first album on Doppelganger (?) to the new one.
I've been enjoying the new Voivod more than I thought I would. I was a big fan of the band up until the Outer Limits, with Dimension Hatross holding a special place in my heart. The advance CDR I received is a but messed-up soundwise, it seems like it's taken from mp3s and is very hissy (sounds terrible in headphones) but there are some great songs on it. I am very much looking forward to getting a proper copy of it.
That Wolfmother album is like Sabbath/Budgie/Zeppelin lite. Listened to it twice while driving long distance on Saturday. I didn't hate it, but it wasn't great.
Does anyone know if the tape is slowed down on the Witchfinder General Live '83 CD? Seriously?
Also, the Bedemon compilation on Black Widow Records from Italy is a gret companion to the new Pentagram reissue on Relapse.
― Sean Palmerston (Palms), Tuesday, 16 May 2006 16:05 (nineteen years ago)
― pdf (Phil Freeman), Tuesday, 16 May 2006 16:37 (nineteen years ago)
Also: anyone remember an obscure little California group by the name of Van Halen? 1984 is probably the ultimate example of this sub-sub-genre (and not just because it sold like 800 billion copies). I was a little kid when this came out and much more interested in what Captain America and the Hulk and Daredevil were up to every month rather than what was on the radio and I remember 'Jump' being fricking everywhere. I can identify that song after one SECOND - all I need to hear is the hum that the keyboard makes before a note is even played.
A few years later, the biggest hard rock record in the US (and probably everywhere else) is APPETITE FOR DESTRUCTION; if you can find any new wave on that, you win a prize. Shortly after that, Metallica's "One" perches on the top of Dial MTV for like 8 weeks. So: where did new wave go? I mean where did the new wave in hard rock go - within five years we'd gone from keyboards in your songs and red jumpsuits on your bandmates and flourescent quadrillaterals on your record jacket to "DARKNESS! IMPRISONING ME! ALL THAT I SEE! ABSOLUTE HORROR! ETC.!" Yeah, I know, trends come and go. But Martin Popoff once said that the worldwide metal scene is so vast and varied and weird that, once a particular metal subgenre starts up somewhere, it lasts forever. There's always gonna be black metal bands and hair metal bands and prog metal and blues metal and goth metal and every other thing. I may not get every CD that comes out, but I *never* hear anything that sounds like 'Jump' (or 'Turn Me Loose' or 'Cold as Ice' or...) anymore. I think you could probably find new wave sounds in most music in the late 80s and into the early 90s - although eventually all the stuff that used to sound wave becomes just another regular part of pop grammar, just like drums and guitars and such. But I think at some point new wave ceased to exist in a hard rock context (or maybe I mean that the other way around...) When I was in junior high and high school, people into ‘real’ metal would’ve sooner jumped off a bridge than listen to 1984 (let alone 1994!). Plus there was all that “there were NO synthesizers used on this record!” malarky...
― Handsome Dan, Wednesday, 17 May 2006 02:59 (nineteen years ago)
Oop, unless you count Faith No More or Ministry or White Zombie or Prong. Or several others. And I guess Rammstein and the Killing Joke just put out records. Do those all count as new wave (or n.w.-influenced or n.w.-derived?) And what even counts as "new wave sounds" anyway? Keyboards only? Certain kinds of beats? I'm becoming confused...
I also like ORGASMATRON, and (in order to add a "2006" component to the "rolling" and "metal" portion of this post) I look forward to buying the Madder Mortem CD tomorrow. And what's this about a new Voivod record? Did they replace Piggy? Is the Metallica guy still on board?
― Handsome Dan, Wednesday, 17 May 2006 03:20 (nineteen years ago)
Osaka Popstar and the Legends of American Punk Rock [eyes roll, what a name] which is 2006 count as "new wave" by punk metal dudes. The record certainly goes overtime into power pop.
― George 'the Animal' Steele, Wednesday, 17 May 2006 04:08 (nineteen years ago)
I'm absolutely loving that one, it's one of the best albums they've ever done, period. Monotheist and the new Katatonia are my 2006 front-runners so far.
I've been enjoying the new Voivod more than I thought I would.
I've only been able to give it just one spin in the past week or so. It seems to be much more groove-oriented than the last album...I need more time with it. I've been playing "The X-Stream" a lot in the last month. Great little tune.
Anyone else here digging the new Misery Index? I'm liking it a lot, it's reminding me a fair bit of the last Red Chord cd, ultra-tight death-grind, but with a bit more variety tossed in compared to their debut. Plus their political lyrics are actually very good.
― a. begrand (a begrand), Wednesday, 17 May 2006 04:17 (nineteen years ago)
Second on my list of favorite recent song titles is Burialmound's *At Golgotha I Masturbate*. Cuz everyone knows how horny you get by the time you reach Golgotha. Maybe Burialmound should have had the huge demonic penis on the cover of their album.
― scott seward (scott seward), Thursday, 18 May 2006 19:05 (nineteen years ago)
― pdf (Phil Freeman), Thursday, 18 May 2006 19:11 (nineteen years ago)
!
Meantime, Lordi, then.
― Ned Raggett (Ned), Monday, 22 May 2006 19:01 (nineteen years ago)
http://www.dickdestiny.com/blog/2006/05/he-was-metal-man-before-you-ii-nothing.html
Watched SuperGroup last night. Didn't know what to make of it. Ted Nugent looks like a granddad in his Hawaiian shirt. Heck, maybe he is a granddad!?
― George 'the Animal' Steele, Monday, 22 May 2006 19:17 (nineteen years ago)
― Brigadier Lethbridge-Pfunkboy (Kerr), Monday, 22 May 2006 19:50 (nineteen years ago)
Maybe I should search them on youtube...
― xhuxk, Monday, 22 May 2006 20:19 (nineteen years ago)
Tha video: http://www.youtube.com/watch?v=fVFw1cI2XjU&search=lordi
At l'Eurovision: http://www.youtube.com/watch?v=OqBGffYpE9I&search=lordi
Someone with too much time on their hands: http://www.youtube.com/watch?v=6w2QRaSfgzM&search=lordi
― Handsome Dan, Tuesday, 23 May 2006 03:37 (nineteen years ago)
---
Okey, i has never been a big fan of these monster rockers but after i heard this album i have been a quite big fan. There first and second albums only contained some good songs and most of the songs was really bad. This album got everything better, it got better mixing, better music, better vocals and better lyrics.The whole album begins with an TV-News intro spoken by no less than Twisted Sisters frontman Dee Snider.Then it kicks into a solid hardrock song namely The Deadite Girls Gone Wild.But it's when the third songs things start to happen. The Kids Who Wanna Play with the Dead. It's got a good chorus and a nice hard rock riff. The Singing on this one is also a bit better than on the previous track.It snows in Hell is a slower track and it's perfect after 2 faster songs. The Riff is a real "snow" riff. Catchy chorus to.Who's your daddy is one of the heaviest tracks on the album and it's one of the weaker to. Good music and everything but the song is a normal Lordi song that would have fit in better on there previous album.Okey, now the real part begins! On They Only Come Out at Night Mr. Lordi sings a duet with the former Accept singer UDO. And it's fits perfectly with the music. A catchy chorus and a nice solo is also a big plus.The 2 next songs, Chainsaw Buffet and Good to Be Bad is 2 solid Lordi songs that fills out the album.The Night of the Living Dead is the best song on the album in my opinion. It starts off with a riff that reminds me off a riff from Savatage's Gutter Ballet. Lordi has never sung as good on this song. And the chorus is very very cathcy!Supermonstars is the heaviest song on this album and it's a little weak but a nice closer of the album.
If you liked the old albums you will love this one and if you don't like Lordi i think you shall give this album a shot cause it rocks!
Best songs:The Kids Who Wanna Play with the DeadThey Only Come Out at NightThe Night of the Living Dead
P.S It was good that they didn't include there Hard rock Hallelujah on this album because it would have ruined the album.
Edit (The day after i had write the review). On my promo version it missed 2 songs which are with on the original and unfortunaly one of them were Hard Rock Hallelujah. And the second was Brining back the balls to the Rock, which are a completly normal Lordi song without anything special. Okey if i would have knowed that i would only had put 3,5 stars in rating but i let the rating stand.
― Ned Raggett (Ned), Tuesday, 23 May 2006 03:40 (nineteen years ago)
http://www.dickdestiny.com/blog/2006/05/bad-texas-bees-beat-your-women-b-and.html
― George 'the Animal' Steele, Monday, 29 May 2006 22:16 (nineteen years ago)
― Handsome Dan, Thursday, 1 June 2006 03:13 (nineteen years ago)
― a. begrand (a begrand), Thursday, 1 June 2006 04:57 (nineteen years ago)
http://www.knowhere.ch/tempstuff/cf/IMG_0487.jpg
― Ian Christe (Ian Christe), Thursday, 1 June 2006 17:03 (nineteen years ago)
http://www.slate.com/id/2124692/
http://www.dickdestiny.com/blog/2006/05/p.html
― George 'the Animal' Steele, Thursday, 1 June 2006 17:14 (nineteen years ago)
― pdf (Phil Freeman), Thursday, 1 June 2006 17:56 (nineteen years ago)
― Je4nn3 ƒur¥ (Je4nne Fury), Thursday, 1 June 2006 20:04 (nineteen years ago)
― a. begrand (a begrand), Thursday, 1 June 2006 21:35 (nineteen years ago)
― rizzx (Rizz), Thursday, 1 June 2006 21:40 (nineteen years ago)
― scott seward (scott seward), Thursday, 1 June 2006 22:06 (nineteen years ago)
http://www.dickdestiny.com/blog/2006/06/beer-drinkers-and-orc-raisers-pop.html
― Urnst Kouch (Urnst Kouch), Friday, 2 June 2006 16:55 (nineteen years ago)
Celtic FrostKorpiklaani
― ryan (ryan), Friday, 2 June 2006 17:21 (nineteen years ago)
http://www.dickdestiny.com/blog/2006/06/wham-bam-british-glam-def-leppards.html
― Urnst Kouch (Urnst Kouch), Monday, 5 June 2006 21:51 (nineteen years ago)
― larssen (larssen), Monday, 12 June 2006 04:02 (nineteen years ago)
Thou art some fool and I'm not loath to beat thee.
― Urnst Kouch (Urnst Kouch), Monday, 12 June 2006 08:33 (nineteen years ago)
So any dm experts this 1500+ post thread might attract.
― larssen (larssen), Monday, 12 June 2006 14:45 (nineteen years ago)
― scott seward (scott seward), Monday, 12 June 2006 14:55 (nineteen years ago)
"Which brings me to this: Katatonia were on Century Media for years. Katatonia has been signed with Peaceville for years. Neither of these nitwit fucking companies could get this band over to tour the States! Ever! Katatonia could be huge in the US. They deserve to be huge here. So stick your overpriced box sets filled with shit every fan already owns up your asses and spring for a motherfucking plane ticket, OK?! (Great packaging, by the way. And thanks for the recent DVD, Peaceville. I guess it’s as close as I’ll get.)"
Here is what i got in my e-mail today:
For Immediate ReleaseJune 12, 2006
KATATONIA / DAYLIGHT DIES / MOONSPELL DATES CONFIRMED
Philadelphia: The first confirmed dates on the anticipated fall tourfeaturing Katatonia and Daylight Dies with headliner Moonspell today areannounced. Set to kick off in Poughkeepsie, New York more dates for thetour are expected to be announced in the coming weeks.
For Katatonia, currently promoting their latest album The Great ColdDistance, this will be the band's first full tour of the United States. Theband's only previous stateside performances include their debut at the nowdefunct Milwaukee Metal Fest and 2004's Brave Words Bloody Knuckles 6-PackWeekend. The Great Cold Distance, released April 4, is the band's fastestselling record in their 10-plus year history. Blabbermouth says, "The GreatCold Distance is a masterpiece of gloom from a band from whom we couldexpect nothing less." The album hit national sales charts in fourinternational territories on release and the album's first video for albumtrack "My Twin" directed by Charlie Granberg, is currently featured atnumerous on-demand as well regional video outlets.
Metal Maniacs calls Dismantling Devotion, the second album from NorthCarolina-based Daylight Dies, “a monster of an album.” Mixed by Jens Bogrenat Fascination Street Studios (Opeth/Soilwork) and mastered by ThomasEberger at The Cutting Room (Opeth/The Hives), Dismantling Devotion is arecord filled with quality musicianship that travels a dark and passionateroad that has nestled itself into the hearts of death, doom and dark musicfans everywhere. In support of their debut No Reply, Daylight Dies lasttoured the US in support of Lacuna Coil in 2003. The band are currentlyworking on their first video and preparing for their sold out showsalongside Emperor in mid-July.
Confirmed dates as of press time are noted below.
10/20 - The Loft, Poughkeepsie NY10/21 - Mark's Place, Bedford NH10/22 - BB Kings Blues Club, New York NY10/23 - Medley, Montreal QU10/24 - L'Imperial, Quebec City QU10/25 - Opera House, Toronto ON10/26 - Peabody's, Cleveland OH10/27 - IRock, Detroit MI10/28 - Pearl Room, Mokena IL10/29 - Star Central, Columbia Heights MN10/31 - Lliff Park Saloon, Aurora CO11/02 - Studio Seven, Seattle WA11/03 - Rock N Roll Pizza, Portland OR11/04 - Pound @ Pier 96, San Francisco CA11/06 - House of Blues, Anaheim CA11/11 - White Rabbit, San Antonio TX
― scott seward (scott seward), Monday, 12 June 2006 14:57 (nineteen years ago)
― scott seward (scott seward), Monday, 12 June 2006 14:58 (nineteen years ago)
― pdf (Phil Freeman), Monday, 12 June 2006 15:00 (nineteen years ago)
― xhuxk (xheddy), Monday, 12 June 2006 15:02 (nineteen years ago)
― xhuxk (xheddy), Monday, 12 June 2006 15:06 (nineteen years ago)
― scott seward (scott seward), Monday, 12 June 2006 15:09 (nineteen years ago)
― scott seward (scott seward), Monday, 12 June 2006 15:10 (nineteen years ago)
― pdf (Phil Freeman), Monday, 12 June 2006 15:18 (nineteen years ago)
Here is Urge's website (apparently there's a 14-day free trial deal):
http://www.urge.com/switch/index.jhtml?section=home
― xhuxk (xheddy), Monday, 12 June 2006 15:22 (nineteen years ago)
― larssen (larssen), Monday, 12 June 2006 15:30 (nineteen years ago)
It's a fun blog! I liked the Survivor entry, though I was kind of hoping he'd discuss their brand new album.
― Sang Freud (jeff_s), Monday, 12 June 2006 15:53 (nineteen years ago)
there are lotsa death metal picks on this thread.
More true words have never been said here.
― Urnst Kouch (Urnst Kouch), Monday, 12 June 2006 16:34 (nineteen years ago)
― larssen (larssen), Monday, 12 June 2006 17:29 (nineteen years ago)
-- George the Animal Steele (george_the_animal_steele...), February 6th, 2006.
― xhuxk (xheddy), Monday, 12 June 2006 17:32 (nineteen years ago)
― larssen (larssen), Monday, 12 June 2006 17:57 (nineteen years ago)
― pdf (Phil Freeman), Monday, 12 June 2006 19:07 (nineteen years ago)
And Phil, if you've got a Universal Finland contact for that Lordi catalogue, and feel like passing it on to me, I doubt I'd complain.
― xhuxk (xheddy), Monday, 12 June 2006 19:49 (nineteen years ago)
I went through their website - www.lordi.org. Browse around and you'll find management and press e-mail contacts quick enough.
― pdf (Phil Freeman), Monday, 12 June 2006 20:16 (nineteen years ago)
"Neuraxis was a pretty good call, which was the first mention of them in the thread."
probably cuz their last album came out last year and this thread is about more recent releases/reissues. check the 2005 thread. i dare you! i second the neuraxis love. just buy everything that willowtip put out last year. they were on a roll.
― scott seward (scott seward), Tuesday, 13 June 2006 12:31 (nineteen years ago)
and i thought of george when i read the press-notes to the new album by william elliott whitmore, a dude who makes deathfolkcountry and who is a FARMER from IOWA. i quote: "For the past year, William has been touring in between harvests..."
How fucking hardcore is THAT!? TOURING between HARVESTS!!! take THAT, bonnie prince billy!!
― scott seward (scott seward), Tuesday, 13 June 2006 12:40 (nineteen years ago)
― xhuxk (xheddy), Tuesday, 13 June 2006 12:53 (nineteen years ago)
― pdf (Phil Freeman), Tuesday, 13 June 2006 12:58 (nineteen years ago)
― rizzx (Rizz), Tuesday, 13 June 2006 13:00 (nineteen years ago)
I think I've heard one song of this and will not be seeking out the rest. It sounded Swansong quality. I don't get what he's trying to achieve with this. Aside from Necroticism I don't think Carcass had very good covers, but have you seen the cover for this? It's just tacky. Carcass was vulgar, but I don't think they were tacky. "Cuntry"? But the real problem is in the second sentence.
― larssen (larssen), Tuesday, 13 June 2006 20:57 (nineteen years ago)
― don (dow), Wednesday, 14 June 2006 18:41 (nineteen years ago)
― pm (p-m), Wednesday, 14 June 2006 19:19 (nineteen years ago)
― pdf (Phil Freeman), Wednesday, 14 June 2006 19:32 (nineteen years ago)
― don (dow), Wednesday, 14 June 2006 21:33 (nineteen years ago)
I've been thinking the exact same thing lately. Ruun is tremendous. Deceptively catchy, too.
And yeah, the new Voivod has grown on me in a massive way over the last month. I haven't been this nutty over a Voivod album since 1989. As of right now, it's right behind Celtic Frost and Katatonia for the best metal disc of the year, in my opinion.
― a. begrand (a begrand), Wednesday, 14 June 2006 22:07 (nineteen years ago)
― don (dow), Wednesday, 14 June 2006 23:10 (nineteen years ago)
― pdf (Phil Freeman), Thursday, 15 June 2006 17:39 (nineteen years ago)
― Sundar (sundar), Thursday, 15 June 2006 19:05 (nineteen years ago)
― don (dow), Thursday, 15 June 2006 19:39 (nineteen years ago)
(BTW, sorry if it's been mentioned already on this massive thread but are there any good internet radio stations that play some of the things discussed here? The Knut sounds interesting, for example, as well as some of the things xhuxk mentions.)
― Sundar (sundar), Thursday, 15 June 2006 20:43 (nineteen years ago)
More groove, but it's still quintessential Voivod: Piggy sounds like Piggy (bless 'im), Away sounds like Away, Snake sings some of his best lyrics to date. There are elements from those three albums, but it's a much more cohesive record than the 2003 disc. "Polaroids" is the most prog-oriented song. The next album is apparently going to be more in that kind of direction.
― a. begrand (a begrand), Thursday, 15 June 2006 20:57 (nineteen years ago)
http://www.dickdestiny.com/blog/2006/06/witchfinder-generals-loved-sex-rock.html
― Urnst Kouch (Urnst Kouch), Friday, 16 June 2006 14:56 (nineteen years ago)
next album?! they're going on without piggy?
― GOD PUNCH TO HAWKWIND (yournullfame), Friday, 16 June 2006 22:11 (nineteen years ago)
― scott seward (scott seward), Friday, 16 June 2006 22:20 (nineteen years ago)
lots of folks i know in mpls like WEW...he plays with lots of punk bands and stuff from around here...apparently a real nice dude.
― M@tt He1geson (Matt Helgeson), Friday, 16 June 2006 22:24 (nineteen years ago)
― M@tt He1geson (Matt Helgeson), Friday, 16 June 2006 22:25 (nineteen years ago)
― scott seward (scott seward), Friday, 16 June 2006 22:27 (nineteen years ago)
You can do amazing things with beat mapping in software, but you can't manufacture inspiration or the magic that occurs when people compose and play together. That's the way it is. Guitar music isn't just mechanization, not even for Voivod.
a dude who makes deathfolkcountry and who is a FARMER from IOWA
Get him to run on the Republican ticket. Where, where, are you tonight, why did you leave me here all alone? I searched the world over and I thought I find true love, you met another and pffft you were gone. Should xpost to the noise country thread.
Here, busy yourself with something off topic and intelligent. Stretch your brain, the pictures are funny, and hundreds are reading it as we speak -- Assassination by Toilet Paper and The Botox Shoe of Death:
http://www.dickdestiny.com/blog/2006/06/from-poisoners-handbook-to-botox-shoe.html
― Urnst Kouch (Urnst Kouch), Friday, 16 June 2006 22:31 (nineteen years ago)
Crimson Glory, *Transcendence* (MCA album, 1988)Metal Church, *Blessing in Disguise* (Elektra album, 1989)Jerusalem, *Can't Stop Us Now* (Refuge album, 1983)Rail, "1-2-3 Rock and Roll"/"Fantasy"/"You've Got to Give"/"Hard Girl to Love" (EMI America EP, 1984)Sampson, "The Fight Goes On"/"Riding With The Angels"/"Vice Versa (Live)" (Polydor EP, 1984)
thanks!
― xhuxk (xheddy), Saturday, 24 June 2006 16:18 (nineteen years ago)
"Riding with the Angels" was a great studio cut when Bruce Bruce sang it on Shock Tactics. I was never sold on it redone with Moore.
― Urnst Kouch (Urnst Kouch), Saturday, 24 June 2006 18:21 (nineteen years ago)
Crimson Glory's Transcendence was ahead of its time, no question, but there's something about the sound of it that always struck me as a bit cold.
Heh, I remember Rail. "1-2-3 Rock and Roll" was as goofy a metal rave-up as Helix's "Rock You".
― a. begrand (a begrand), Saturday, 24 June 2006 21:28 (nineteen years ago)
― scott seward (scott seward), Saturday, 24 June 2006 21:38 (nineteen years ago)
― scott seward (scott seward), Saturday, 24 June 2006 21:47 (nineteen years ago)
The power metal album I did really like this week was by Warmachine, who are from Toronto, and whose new album is on Nightmare Records.
― xhuxk (xheddy), Saturday, 24 June 2006 22:28 (nineteen years ago)
― scott seward (scott seward), Saturday, 24 June 2006 22:36 (nineteen years ago)
but, you know, a little longer.
― scott seward (scott seward), Saturday, 24 June 2006 22:38 (nineteen years ago)
Where is the LOVE for Cirith Ungol?
Everyone in Dick Destiny had Cirith Ungol Lps except the drummer. It was back when we ate shoe leather and liked it! Maybe I should do a poor man's entry for them on the blog for Sunday. Maybe not.
So, when's xhuxk gonna discover Max Gelt and the Broadway Metal Choir's And God Gave Us Max!. I actually Had to interview him because he had some feeble local connection in the newspaper's circulation area. And there's still only one or two entries on the entire web for him. Damn.
― Urnst Kouch (Urnst Kouch), Saturday, 24 June 2006 22:47 (nineteen years ago)
xp for Scott, re Agalloch or Agollach as the case may be:
I liked it (though maybe not as much you I guess)! I wrote about it on my MTV Urge blog! My favorite songs were the ones with the '80s AOR-melody diddles sneakily snuck in there - "Falling Snow" and "Not Unlike the Waves," as I recall. (I think I might like those Lacrimos Profundere and Leaves Eyes EPs on Napalm more, though. But the Lacrimos Profundere ALBUM is too much of a ridiculous thing. Sisters of Mercy tributes are much more palatable when kept to EP length.)
My favorite metal album of the year is still by Korpiklaani, however.
― xhuxk (xheddy), Saturday, 24 June 2006 22:48 (nineteen years ago)
― xhuxk (xheddy), Saturday, 24 June 2006 22:53 (nineteen years ago)
― scott seward (scott seward), Saturday, 24 June 2006 22:57 (nineteen years ago)
Still never figured out what was supposed to be so great about the Moonspell album, sadly enough. It was fine -- just another okay Moonspell album, no complaints, but still, Scott said it was their best in years, and I still can't figure out why. And Katatonia and Madder Mortem are in the same category; i.e., they sound good when I put them on, but when I don't, I can't remember anything about them.)
Somebody mentioned Knut. I never heard their "actual" album, just their remix one, which struck me as theoretically intriguing for a few minutes, but there was nothing on it I cared about returning to.
― xhuxk (xheddy), Saturday, 24 June 2006 23:09 (nineteen years ago)
http://www.decibelmagazine.com/reviews/june2006/moonspell.aspx
i just thought it was really powerful in a way that the last three albums weren't. plus, their last three albums sounded like mud. the new one was so shiny and heavy and catchy and all that good stuff. the SONGS are better too.
― scott seward (scott seward), Saturday, 24 June 2006 23:16 (nineteen years ago)
― scott seward (scott seward), Saturday, 24 June 2006 23:17 (nineteen years ago)
some other random metal stuff i've written about on that urge blog:
end records compilation: i decided that unexpect's cut and thin eyes bleed's cuts weren't as horrible as most of the other cuts
invaders compilation: i decided that danava's cut and warhammer 48K's cuts weren't as horrible as most of the other cuts
the gersch: one good track ("residue three"), the rest is expendable
new zao album: one good track ("a last time for everything"); the rest is expendable
also: assorted unknown myspace bands, and sundry other stuff.
and oh yeah: fuck an albatross.
― xhuxk (xheddy), Saturday, 24 June 2006 23:29 (nineteen years ago)
Virgin Black were even better. Seemed to be off some CD where they collaborate with a classical Australian orchestra, but I never heard said album. (I also had no idea that Australia had any orchestras.)
― xhuxk (xheddy), Saturday, 24 June 2006 23:35 (nineteen years ago)
― scott seward (scott seward), Saturday, 24 June 2006 23:37 (nineteen years ago)
― scott seward (scott seward), Saturday, 24 June 2006 23:40 (nineteen years ago)
Dickie Peterson is still pretty much a frizzed-out hippie rebel. As Dickie leaned against his amp watching Paul Whaley butcher a drum solo, it was easy to picture him slouching against a small-town drugstore storefront in hicksville North Dakota in 1965, like a tough from Born Losers or something. Glad to see a hippie with a lifelong gift for going against the grain. I thought they all bought SUVs like Grace Slick. Anyway, B'Cheer played all of Vincebus Eruptum at deafening volume. I caught glimpses into a bygone era. I appreciate that they fought for my rights before I was born.
Made me want to go read my old issues of Flesh + Bones, too -- godly '80s dirtrocker zine from Jersey that saw the future.
― Ian Christe (Ian Christe), Sunday, 25 June 2006 00:49 (nineteen years ago)
No, you're probably right, 1988 was the right time for that album to come out, right when that whole epic power metal thing was starting to gain serious momentum (post-Awaken the Guardian, pre-Keeper Part II, pre-Gutter Ballet, pre-Dream Theater). I can't remember Crimson Glory ever getting the kind of attention those other bands did at the time. I have to listen to that album again.
i put in a good word for leaves' eyes in my pan of the new theatre of tragedy album in the new decibel.
Heh, I'm reviewing the new EP. It's okay. A bit heavier than the last album, which went new-age too many times for my liking, the songs are half decent. I kind of like Liv Kristine's replacement in Theatre of Tragedy.
that's gonna be my review: "I lovelovelovelovelovelovleovelvoelvoelvoleovleovleolvoelovelovelovelovleovleovleovleove the new agalloch album. A lot!"
Currently my third favourite metal album of the year, behind Celtic Frost and Katatonia, just ahead of Voivod.
The new Unearth is surprisingly good for no-frills metalcore.
And I'm finding myself less than enamoured of the new Skullflower.
― a. begrand (a begrand), Sunday, 25 June 2006 02:44 (nineteen years ago)
― don (dow), Sunday, 25 June 2006 07:22 (nineteen years ago)
― don (dow), Sunday, 25 June 2006 07:33 (nineteen years ago)
yeah, i originally thought ian was a brit too!
― latebloomer aka rap's yoko ono (latebloomer), Sunday, 25 June 2006 07:41 (nineteen years ago)
>do you mean you wrote about the *new* Voivod for Spin<
yep
>...in the issue that already came out<
nope. the next one, i think. i wrote three CD reviews for that one, then six (!?) for the issue after that. (hey, i'm suprised, too.)
― xhuxk (xheddy), Sunday, 25 June 2006 08:10 (nineteen years ago)
― don (dow), Sunday, 25 June 2006 18:07 (nineteen years ago)
― rizzx (Rizz), Sunday, 25 June 2006 21:24 (nineteen years ago)
― Thomas Tallis (Tommy), Sunday, 25 June 2006 22:14 (nineteen years ago)
xp: which one? orange canyon mind (which was crap) or tribulations or what?
― GOD PUNCH TO HAWKWIND (yournullfame), Sunday, 25 June 2006 23:00 (nineteen years ago)
Tribulation. A little too formless, no percussion, just an hour-long onslaught of grating, screeching distortion with tiny, tiny hints of melodies buried underneath all the density. I liken it to a badly tuned AM radio...you can hear traces of something, but the static is overwhelming. It's interesting in small doses, especially with headphones (there are a few tracks I really like), but in my opinion, I've heard better from Bower.
I greatly prefer Xaman, Exquisite Fucking Boredom, and yeah, even Orange Canyon Mind.
― a. begrand (a begrand), Monday, 26 June 2006 00:01 (nineteen years ago)
― pdf (Phil Freeman), Monday, 26 June 2006 00:56 (nineteen years ago)
http://www.youtube.com/watch?v=p7_JafYlMY8
Does this buzz around DragonForce mean we're in for a big power metal revival in North America? It's so popular in Europe, but there haven't been signs of the same thing happening here, until recently.
There's a band from Omaha called Cellador that does the Helloween shtick quite well, including a singer who matches Kiske step for step.
― a. begrand (a begrand), Monday, 26 June 2006 01:56 (nineteen years ago)
― scott seward (scott seward), Monday, 26 June 2006 02:06 (nineteen years ago)
― pdf (Phil Freeman), Monday, 26 June 2006 14:01 (nineteen years ago)
― scott seward (scott seward), Monday, 26 June 2006 15:44 (nineteen years ago)
― Ian Christe (Ian Christe), Monday, 26 June 2006 15:53 (nineteen years ago)
― robbie mackey (robbie mackey), Monday, 26 June 2006 18:54 (nineteen years ago)
― pdf (Phil Freeman), Tuesday, 27 June 2006 13:36 (nineteen years ago)
― GOD PUNCH TO HAWKWIND (yournullfame), Tuesday, 27 June 2006 13:49 (nineteen years ago)
― xhuxk (xheddy), Tuesday, 27 June 2006 15:00 (nineteen years ago)
― scott seward (scott seward), Tuesday, 27 June 2006 15:04 (nineteen years ago)
Rolling 2006 Metal Thread, Part 2
― scott seward (scott seward), Tuesday, 27 June 2006 15:09 (nineteen years ago)